KEGG   Homo sapiens (human): 80854Help
Entry
80854             CDS       T01001                                 

Gene name
SETD7, KMT7, SET7, SET7/9, SET9
Definition
SET domain containing (lysine methyltransferase) 7 (EC:2.1.1.43)
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
FoxO signaling pathway
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q28
AA seq 366 aa AA seqDB search
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRP
HFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgacgacgagatggtggaggaggcggtggaagggcacctggacgatgacgga
ttaccgcacgggttctgcacagtcacctactcctccacagacagatttgaggggaacttt
gttcacggagaaaagaacggacgggggaagttcttcttctttgatggcagcaccctggag
gggtattatgtggatgatgccttgcagggccagggagtttacacttacgaagatggggga
gttctccagggcacgtatgtagacggagagctgaacggtccagcccaggaatatgacaca
gatgggagactgatcttcaaggggcagtataaagataacattcgtcatggagtgtgctgg
atatattacccagatggaggaagccttgtaggagaagtaaatgaagatggggagatgact
ggagagaagatagcctatgtgtaccctgatgagaggaccgcactttatgggaaatttatt
gatggagagatgatagaaggcaaactggctacccttatgtccactgaagaagggaggcct
cactttgaactgatgcctggaaattcagtgtaccactttgataagtcgacttcatcttgc
atttctaccaatgctcttcttccagatccttatgaatcagaaagggtttatgttgctgaa
tctcttatttccagtgctggagaaggacttttttcaaaggtagctgtgggacctaatact
gttatgtctttttataatggagttcgaattacacaccaagaggttgacagcagggactgg
gcccttaatgggaacaccctctcccttgatgaagaaacggtcattgatgtgcctgagccc
tataaccacgtatccaagtactgtgcctccttgggacacaaggcaaatcactccttcact
ccaaactgcatctacgatatgtttgtccacccccgttttgggcccatcaaatgcatccgc
accctgagagcagtggaggccgatgaagagctcaccgttgcctatggctatgaccacagc
ccccccgggaagagtgggcctgaagcccctgagtggtaccaggtggagctgaaggccttc
caggccacccagcaaaagtga

DBGET integrated database retrieval system