KEGG   Homo sapiens (human): 8087Help
Entry
8087              CDS       T01001                                 

Gene name
FXR1, FXR1P
Definition
(RefSeq) FMR1 autosomal homolog 1
  KO
K15516  
fragile X mental retardation protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8087 (FXR1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     8087 (FXR1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     8087 (FXR1)
   mRNA cycle factors
    Stress granule specific factors
     8087 (FXR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P51114(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.33
AA seq 621 aa AA seqDB search
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLL
DNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADY
ISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGE
EKINTLKEENTQEAAVLNGVS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgacggtggaggttcgcggctctaacggggctttctacaagggatttatc
aaagatgttcatgaagactcccttacagttgtttttgaaaataattggcaaccagaacgc
caggttccatttaatgaagttagattaccaccaccacctgatataaaaaaagaaattagt
gaaggagatgaagtagaggtatattcaagagcaaatgaccaagagccatgtgggtggtgg
ttggctaaagttcggatgatgaaaggagaattttatgtcattgaatatgctgcttgtgac
gctacttacaatgaaatagtcacatttgaacgacttcggcctgtcaatcaaaataaaact
gtcaaaaaaaataccttctttaaatgcacagtggatgttcctgaggatttgagagaggcg
tgtgctaatgaaaatgcacataaagattttaagaaagcagtaggagcatgcagaattttt
taccatccagaaacaacacagctaatgatactgtctgccagtgaagcaactgtgaagaga
gtaaacatcttaagtgacatgcatttgcgaagtattcgtacgaagttgatgcttatgtcc
agaaatgaagaggccactaagcatttagaatgcacaaaacaacttgcagcagcttttcat
gaggaatttgttgtgagagaagatttaatgggcctggcaataggaacacatggtagtaac
atccagcaagctaggaaggttcctggagttaccgccattgagctagatgaagatactgga
acattcagaatctacggagagagtgctgatgctgtaaaaaaggctagaggtttcttggaa
tttgtggaggattttattcaggttcctaggaatctcgttggaaaagtaattggaaaaaat
ggcaaagttattcaagaaatagtggacaaatctggtgtggttcgagtgagaattgaaggg
gacaatgaaaataaattacccagagaagacggtatggttccatttgtatttgttggcact
aaagaaagcattggaaatgtgcaggttcttctagagtatcatattgcctatctaaaggaa
gtagaacagctaagaatggaacgcctacagattgatgaacagctgcgacagattggttct
aggtcttatagcggaagaggcagaggtcgtcggggacctaattacacctccggttatggt
acaaattctgagctgtctaacccctctgaaacggaatctgagcgtaaagacgagctgagt
gattggtcattggcaggagaagatgatcgagacagccgacatcagcgtgacagcaggaga
cgcccaggaggaagaggcagaagtgtttcagggggtcgaggtcgtggtggaccacgtggt
ggcaaatcctccatcagttctgtgctcaaagatccagacagcaatccatacagcttactt
gataatacagaatcagatcagactgcagacactgatgccagcgaatctcatcacagtact
aaccgtcgtaggcggtctcgtagacgaaggactgatgaagatgctgttctgatggatgga
atgactgaatctgatacagcttcagttaatgaaaatgggctagtcacagttgcagattat
atttctagagctgagtctcagagcagacaaagaaacctcccaagggaaactttggctaaa
aacaagaaagaaatggcaaaagatgtgattgaagagcatggtccttcagaaaaggcaata
aacggcccaactagtgcttctggcgatgacatttctaagctacagcgtactccaggagaa
gaaaagattaataccttaaaagaagaaaacactcaagaagcagcagtcctgaatggtgtt
tcataa

DBGET integrated database retrieval system