KEGG   Homo sapiens (human): 80896Help
Entry
80896             CDS       T01001                                 

Gene name
NPL, C112, C1orf13, NAL, NPL1
Definition
N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (EC:4.1.3.3)
Orthology
K01639  
N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25
AA seq 301 aa AA seqDB search
MSRAPGILASWRRAPSLSVQKGSQTARHTCHPEVPLGNCFLPVYKASPLTVTRLWAERLD
QVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALP
FYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFG
VDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKL
GFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAG
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggcccccgggatcctggcttcttggagaagagccccctccctttctgtgcag
aagggcagccaaactgctagacacacctgccacccagaggttccgctgggaaactgcttc
ttacctgtctacaaggccagtcccctcacagttacccgtctttgggctgaaaggctggat
caggtgataattcacgtaggagcactgagcttgaaggagtcacaggaactggcccaacat
gcagcagaaataggagctgatggcatcgctgtcattgcaccgttcttcctcaagccatgg
accaaagatatcctgattaatttcctaaaggaagtggctgctgccgcccctgccctgcca
ttttattactatcacattcctgccttgacaggggtaaagattcgtgctgaggagttgttg
gatgggattctggataagatccccaccttccaagggctgaaattcagtgatacagatctc
ttagacttcgggcaatgtgttgatcagaatcgccagcaacagtttgctttcctttttggg
gtggatgagcaactgttgagtgctctggtgatgggagcaactggagcagtgggcagtacc
tataactacctgggaaaaaagacaaaccagatgttggaggcttttgaacaaaaggacttc
tctttagccctgaactatcagttttgtatccagagatttatcaactttgttgtcaaacta
ggttttggagtgtcacagaccaaagccatcatgactctggtctctgggattccaatgggc
ccaccccggcttccactgcagaaagcctccagggagtttactgatagtgctgaagctaaa
ctgaagagcctggatttcctttctttcactgatttaaaggatggaaacttggaagctggt
agctag

DBGET integrated database retrieval system