KEGG   Homo sapiens (human): 80896Help
Entry
80896             CDS       T01001                                 

Gene name
NPL, C112, C1orf13, NAL, NPL1
Definition
(RefSeq) N-acetylneuraminate pyruvate lyase
  KO
K01639  
N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    80896 (NPL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     80896 (NPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25
AA seq 320 aa AA seqDB search
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSV
SERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWT
KDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLL
DFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFS
LALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKL
KSLDFLSFTDLKDGNLEAGS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggccttcccaaagaagaaacttcagggtcttgtggctgcaaccatcacgccaatgact
gagaatggagaaatcaacttttcagtaattggtcagtatgtggattatcttgtgaaagaa
cagggagtgaagaacatttttgtgaatggcacaacaggagaaggcctgtccctgagcgtc
tcagagcgtcgccaggttgcagaggagtgggtgacaaaagggaaggacaagctggatcag
gtgataattcacgtaggagcactgagcttgaaggagtcacaggaactggcccaacatgca
gcagaaataggagctgatggcatcgctgtcattgcaccgttcttcctcaagccatggacc
aaagatatcctgattaatttcctaaaggaagtggctgctgccgcccctgccctgccattt
tattactatcacattcctgccttgacaggggtaaagattcgtgctgaggagttgttggat
gggattctggataagatccccaccttccaagggctgaaattcagtgatacagatctctta
gacttcgggcaatgtgttgatcagaatcgccagcaacagtttgctttcctttttggggtg
gatgagcaactgttgagtgctctggtgatgggagcaactggagcagtgggcagtacctat
aactacctgggaaaaaagacaaaccagatgttggaggcttttgaacaaaaggacttctct
ttagccctgaactatcagttttgtatccagagatttatcaactttgttgtcaaactaggt
tttggagtgtcacagaccaaagccatcatgactctggtctctgggattccaatgggccca
ccccggcttccactgcagaaagcctccagggagtttactgatagtgctgaagctaaactg
aagagcctggatttcctttctttcactgatttaaaggatggaaacttggaagctggtagc
tag

DBGET integrated database retrieval system