KEGG   Homo sapiens (human): 81030Help
Entry
81030             CDS       T01001                                 

Gene name
ZBP1, C20orf183, DAI, DLM-1, DLM1
Definition
Z-DNA binding protein 1
Orthology
K12965  
Z-DNA binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytosolic DNA-sensing pathway
Class
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.31
AA seq 428 aa AA seqDB search
MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSL
TSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDN
GPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRPDSGRRAKSASIIY
QHNPINMICQNGPNSWISIANSEAIQIGHGNIITRQTVSREDGSAGPRHLPSMAPGDSST
WGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSEGPAHIPPGSPPVSATAAGPEA
SFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPGGVAGSGEGEPG
EDAGRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASHE
GSWWGGGI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggctcctgctgacccgggcagagaaggccaccttgaacaaagaatcctgcag
gtgctgacagaggctggctccccggtgaaacttgcccagctggtgaaggaatgccaagca
cccaagagggagctcaaccaagtcctctaccgaatgaaaaaggagttgaaagtctccctc
acatcccctgccacctggtgcttgggcgggactgatcctgaaggcgagggtcctgcagag
ctggccttgtccagccctgccgagaggccccagcaacatgcagctacaattccagagacc
cctggccctcagttcagccaacaacgggaggaagacatctacaggtttctcaaagacaat
ggtccccagagggccctggtcatcgcccaagcactgggaatgaggacagcaaaagatgtg
aaccgagacttgtacaggatgaagagcaggcaccttctggacatggatgagcagtccaaa
gcatggacgatttaccgcccagattctggaagaagagcaaagtcagcctcaattatttac
cagcacaatccaatcaacatgatctgccagaatggacccaacagctggatttccattgca
aactccgaagccatccagattggacacgggaacatcattacaagacagacagtctccagg
gaggacggttccgccggtccacgccacctcccttcaatggcaccaggtgattcctcaact
tgggggaccctagttgatccctgggggccccaggacatccacatggagcagtccatactg
agacgggtgcagctgggacacagcaatgagatgaggctccacggcgtcccgtccgagggc
cctgcccacatcccccctggcagccccccagtctctgccactgctgccggcccagaagct
tcgtttgaagcaagaattcccagtccaggaactcaccctgagggggaagccgcccagaga
atccacatgaaatcgtgctttctcgaggacgccaccatcggcaacagcaacaaaatgtct
atcagcccaggggtggctggcccaggaggagtcgcagggtctggagagggggagccaggg
gaggacgcaggtcgtcgtcccgcagacacacaatccagaagtcactttcctcgagacatt
ggtcagcccatcactcccagccactcgaagctcacccccaagctggaaactatgactctt
ggaaacaggagtcacaaagctgcagaaggcagccactatgtggatgaagcctcacacgag
gggagctggtggggaggtgggatttag

DBGET integrated database retrieval system