KEGG   Homo sapiens (human): 81035Help
Entry
81035             CDS       T01001                                 

Gene name
COLEC12, CLP1, NSR2, SCARA4, SRCL
Definition
(RefSeq) collectin subfamily member 12
  KO
K10062  
collectin sub-family member 12
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    81035 (COLEC12)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Scavenger receptor with a CTLD (SRCL)
    81035 (COLEC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.32
AA seq 742 aa AA seqDB search
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
TTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGPSGDPGPPGPPGKEGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVG
RESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF
QCEDVNNFICEKDRETVLSSAL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgacttcgcagaggaggaggaggtgcaatccttcggttacaagcggtttggt
attcaggaaggaacacaatgtaccaaatgtaaaaataactgggcactgaagttttctatc
atattattatacattttgtgtgccttgctaacaatcacagtagccattttgggatataaa
gttgtagagaaaatggacaatgtcacaggtggcatggaaacatctcgccaaacctatgat
gacaagctcacagcagtggaaagtgacctgaaaaaattaggtgaccaaactgggaagaaa
gctatcagcaccaactcagaactctccaccttcagatcagacattctagatctccgtcag
caacttcgtgagattacagaaaaaaccagcaagaacaaggatacgctggagaagttacag
gcgagcggggatgctctggtggacaggcagagtcaattgaaagaaactttggagaataac
tctttcctcatcaccactgtaaacaaaaccctccaggcgtataatggctatgtcacgaat
ctgcagcaagataccagcgtgctccagggcaatctgcagaaccaaatgtattctcataat
gtggtcatcatgaacctcaacaacctgaacctgacccaggtgcagcagaggaacctcatc
acgaatctgcagcggtctgtggatgacacaagccaggctatccagcgaatcaagaacgac
tttcaaaatctgcagcaggtttttcttcaagccaagaaggacacggattggctgaaggag
aaagtgcagagcttgcagacgctggctgccaacaactctgcgttggccaaagccaacaac
gacaccctggaggatatgaacagccagctcaactcattcacaggtcagatggagaacatc
accactatctctcaagccaacgagcagaacctgaaagacctgcaggacttacacaaagat
gcagagaatagaacagccatcaagttcaaccaactggaggaacgcttccagctctttgag
acggatattgtgaacatcattagcaatatcagttacacagcccaccacctgcggacgctg
accagcaatctaaatgaagtcaggaccacttgcacagatacccttaccaaacacacagat
gatctgacctccttgaataataccctggccaacatccgtttggattctgtttctctcagg
atgcaacaagatttgatgaggtcgaggttagacactgaagtagccaacttatcagtgatt
atggaagaaatgaagctagtagactccaagcatggtcagctcatcaagaattttacaata
ctacaaggtccaccgggccccaggggtccaagaggtgacagaggatcccagggaccccct
ggcccaactggcaacaagggacagaaaggagagaagggggagcctggaccacctggccct
gcgggtgagagaggcccaattggaccagctggtccccccggagagcgtggcggcaaagga
tctaaaggctcccagggccccaaaggctcccgtggttcccctgggaagcccggccctcag
ggccccagtggggacccaggccccccgggcccaccaggcaaagagggactccccggccct
cagggccctcctggcttccagggacttcagggcaccgttggggagcctggggtgcctgga
cctcggggactgccaggcttgcctggggtaccaggcatgccaggccccaagggccccccc
ggccctcctggcccatcaggagcggtggtgcccctggccctgcagaatgagccaaccccg
gcaccggaggacaatggctgcccgcctcactggaagaacttcacagacaaatgctactat
ttttcagttgagaaagaaatttttgaggatgcaaagcttttctgtgaagacaagtcttca
catcttgttttcataaacactagagaggaacagcaatggataaaaaaacagatggtaggg
agagagagccactggatcggcctcacagactcagagcgtgaaaatgaatggaagtggctg
gatgggacatctccagactacaaaaattggaaagctggacagccggataactggggtcat
ggccatgggccaggagaagactgtgctgggttgatttatgctgggcagtggaacgatttc
caatgtgaagacgtcaataacttcatttgcgaaaaagacagggagacagtactgtcatct
gcattataa

DBGET integrated database retrieval system