KEGG   Homo sapiens (human): 81099Help
Entry
81099             CDS       T01001                                 

Gene name
OR4F17, OR4F11P, OR4F18, OR4F19
Definition
(RefSeq) olfactory receptor family 4 subfamily F member 17
  KO
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81099 (OR4F17)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81099 (OR4F17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
19p13.3
AA seq 305 aa AA seqDB search
MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH
SSVKF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgaattcatttttctgggtctctctgattctcagggactccagaccttccta
tttatgttgttttttgtattctatggaggaatcgtgtttggaaaccttcttattgtcata
acagtggtatctgactcccaccttcactctcccatgtacttcctgctagccaacctctca
ctcattgatctgtctctgtcttcagtcacagcccccaagatgattactgactttttcagc
cagcgcaaagtcatctctttcaagggctgccttgttcagatatttctccttcacttcttt
ggtgggagtgagatggtgatcctcatagccatgggctttgacagatatatagcaatatgc
aaacccctacactacactacaattatgtgtggcaacgcatgtgtcggcattatggctgtc
gcatggggaattggctttctccattcggtgagccagttggcctttgccgtgcacttaccc
ttctgtggtcccaatgaggtcgatagtttttattgtgaccttcctagggtaatcaaactt
gcctgtacagatacctacaggctagatattatggtcattgctaacagtggtgtgctcact
gtgtgttcttttgttcttctaatcatctcatacactatcatcctaatgaccatccagcat
cgccctttagataagtcgtccaaagctctgtccactttgactgctcacattacagtagtt
cttttgttctttggaccatgtgtctttatttatgcctggccattccccatcaagtcatta
gataaattccttgctgtattttattctgtgatcacccctctcttgaacccaattatatac
acactgaggaacaaagacatgaagacggcaataagacagctgagaaaatgggatgcacat
tctagtgtaaagttttag

DBGET integrated database retrieval system