KEGG   Homo sapiens (human): 81099Help
Entry
81099             CDS       T01001                                 

Gene name
OR4F17, OR4F11P, OR4F18, OR4F19
Definition
olfactory receptor, family 4, subfamily F, member 17
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 305 aa AA seqDB search
MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH
SSVKF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgaattcatttttctgggtctctctgattctcagggactccagaccttccta
tttatgttgttttttgtattctatggaggaatcgtgtttggaaaccttcttattgtcata
acagtggtatctgactcccaccttcactctcccatgtacttcctgctagccaacctctca
ctcattgatctgtctctgtcttcagtcacagcccccaagatgattactgactttttcagc
cagcgcaaagtcatctctttcaagggctgccttgttcagatatttctccttcacttcttt
ggtgggagtgagatggtgatcctcatagccatgggctttgacagatatatagcaatatgc
aaacccctacactacactacaattatgtgtggcaacgcatgtgtcggcattatggctgtc
gcatggggaattggctttctccattcggtgagccagttggcctttgccgtgcacttaccc
ttctgtggtcccaatgaggtcgatagtttttattgtgaccttcctagggtaatcaaactt
gcctgtacagatacctacaggctagatattatggtcattgctaacagtggtgtgctcact
gtgtgttcttttgttcttctaatcatctcatacactatcatcctaatgaccatccagcat
cgccctttagataagtcgtccaaagctctgtccactttgactgctcacattacagtagtt
cttttgttctttggaccatgtgtctttatttatgcctggccattccccatcaagtcatta
gataaattccttgctgtattttattctgtgatcacccctctcttgaacccaattatatac
acactgaggaacaaagacatgaagacggcaataagacagctgagaaaatgggatgcacat
tctagtgtaaagttttag

DBGET integrated database retrieval system