KEGG   Homo sapiens (human): 81127Help
Entry
81127             CDS       T01001                                 

Gene name
OR4K15, OR14-20, OR4K15Q
Definition
olfactory receptor, family 4, subfamily K, member 15
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 348 aa AA seqDB search
MLTSLTDLCFSPIQVAEIKSLPKSMNETNHSRVTEFVLLGLSSSRELQPFLFLTFSLLYL
AILLGNFLIILTVTSDSRLHTPMYFLLANLSFIDVCVASFATPKMIADFLVERKTISFDA
CLAQIFFVHLFTGSEMVLLVSMAYDRYVAICKPLHYMTVMSRRVCVVLVLISWFVGFIHT
TSQLAFTVNLPFCGPNKVDSFFCDLPLVTKLACIDTYVVSLLIVADSGFLSLSSFLLLVV
SYTVILVTVRNRSSASMAKARSTLTAHITVVTLFFGPCIFIYVWPFSSYSVDKVLAVFYT
IFTLILNPVIYTLRNKEVKAAMSKLKSRYLKPSQVSVVIRNVLFLETK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctcacttcattaactgatctctgtttctctcctattcaggtagctgaaattaagtcc
cttccaaaatcgatgaatgagacaaatcattctcgggtgacagaatttgtgttgctggga
ctgtctagttcaagggagctccaacctttcttgtttcttacattttcactactttatcta
gcaattctgttgggcaactttctcatcatcctcactgtgacctcagattcccgccttcac
acccccatgtactttctgcttgcaaacctgtcatttatagacgtatgtgttgcctctttt
gctacccctaaaatgattgcagactttctggttgagcgcaagactatttcttttgatgcc
tgcctggcccagattttctttgttcatctcttcactggcagtgaaatggtgctcctagtt
tccatggcctatgaccgttatgttgctatatgcaaacctctccactacatgacagtcatg
agccgtcgtgtatgtgttgtgctcgtcctcatttcatggtttgtgggcttcatccatact
accagccagttggcattcactgttaatctgccattttgtggtcctaataaggtagacagt
tttttctgtgaccttcctctagtgaccaagttagcctgcatagacacttatgttgtcagc
ttactaatagttgcagatagtggctttctttctctgagttcctttctcctcttggttgtc
tcctacactgtaatacttgttacagttaggaatcgctcctctgcaagcatggcgaaggcc
cgctccacattgactgctcacatcactgtggtcactttattctttggaccatgcattttc
atctatgtgtggcccttcagcagttactcagttgacaaagtccttgctgtattctacacc
atcttcacgcttattttaaaccctgtaatctacacgctaagaaacaaagaagtgaaggca
gctatgtcaaaactgaagagtcggtatctgaagcctagtcaggtttctgtagtcataaga
aatgttcttttcctagaaacaaagtaa

DBGET integrated database retrieval system