KEGG   Homo sapiens (human): 8125Help
Entry
8125              CDS       T01001                                 

Gene name
ANP32A, C15orf1, HPPCn, I1PP2A, LANP, MAPM, PHAP1, PHAPI, PP32
Definition
(RefSeq) acidic nuclear phosphoprotein 32 family member A
  KO
K18646  acidic leucine-rich nuclear phosphoprotein 32 family member A/C/D
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     8125 (ANP32A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_4 LRR_8 LRR_6 LRR_1 SDA1
Motif
Other DBs
NCBI-GeneID: 8125
NCBI-ProteinID: NP_006296
OMIM: 600832
HGNC: 13233
Ensembl: ENSG00000140350
Vega: OTTHUMG00000154502
Pharos: P39687(Tbio)
UniProt: P39687
Structure
PDB: 

Jmol
Position
15q23
AA seq 249 aa AA seqDB search
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagatgggcagacggattcatttagagctgcggaacaggacgccctctgatgtgaaa
gaacttgtcctggacaacagtcggtcgaatgaaggcaaactcgaaggcctcacagatgaa
tttgaagaactggaattcttaagtacaatcaacgtaggcctcacctcaatcgcaaactta
ccaaagttaaacaaacttaagaagcttgaactaagcgataacagagtctcagggggcctg
gaagtattggcagaaaagtgtccgaacctcacgcatctaaatttaagtggcaacaaaatt
aaagacctcagcacaatagagccactgaaaaagttagaaaacctcaagagcttagacctt
ttcaattgcgaggtaaccaacctgaacgactaccgagaaaatgtgttcaagctcctcccg
caactcacatatctcgacggctatgaccgggacgacaaggaggcccctgactcggatgct
gagggctacgtggagggcctggatgatgaggaggaggatgaggatgaggaggagtatgat
gaagatgctcaggtagtggaagacgaggaggacgaggatgaggaggaggaaggtgaagag
gaggacgtgagtggagaggaggaggaggatgaagaaggttataacgatggagaggtagat
gacgaggaagatgaagaagagcttggtgaagaagaaaggggtcagaagcgaaaacgagaa
cctgaagatgagggagaagatgatgactaa

DBGET integrated database retrieval system