KEGG   Homo sapiens (human): 81285Help
Entry
81285             CDS       T01001                                 

Gene name
OR51E2, OR51E3P, OR52A2, PSGR
Definition
(RefSeq) olfactory receptor family 51 subfamily E member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81285 (OR51E2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81285 (OR51E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF4408
Motif
Other DBs
NCBI-GeneID: 81285
NCBI-ProteinID: NP_110401
OMIM: 611268
HGNC: 15195
Ensembl: ENSG00000167332
Vega: OTTHUMG00000133362
Pharos: Q9H255(Tbio)
UniProt: Q9H255 A0A126GVK0
Position
11p15.4
AA seq 320 aa AA seqDB search
MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC
VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDLQAVGGK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctgcaacttcacacatgccacctttgtgcttattggtatcccaggattagag
aaagcccatttctgggttggcttccccctcctttccatgtatgtagtggcaatgtttgga
aactgcatcgtggtcttcatcgtaaggacggaacgcagcctgcacgctccgatgtacctc
tttctctgcatgcttgcagccattgacctggccttatccacatccaccatgcctaagatc
cttgcccttttctggtttgattcccgagagattagctttgaggcctgtcttacccagatg
ttctttattcatgccctctcagccattgaatccaccatcctgctggccatggcctttgac
cgttatgtggccatctgccacccactgcgccatgctgcagtgctcaacaatacagtaaca
gcccagattggcatcgtggctgtggtccgcggatccctcttttttttcccactgcctctg
ctgatcaagcggctggccttctgccactccaatgtcctctcgcactcctattgtgtccac
caggatgtaatgaagttggcctatgcagacactttgcccaatgtggtatatggtcttact
gccattctgctggtcatgggcgtggacgtaatgttcatctccttgtcctattttctgata
atacgaacggttctgcaactgccttccaagtcagagcgggccaaggcctttggaacctgt
gtgtcacacattggtgtggtactcgccttctatgtgccacttattggcctctcagtggta
caccgctttggaaacagccttcatcccattgtgcgtgttgtcatgggtgacatctacctg
ctgctgcctcctgtcatcaatcccatcatctatggtgccaaaaccaaacagatcagaaca
cgggtgctggctatgttcaagatcagctgtgacaaggacttgcaggctgtgggaggcaag
tga

DBGET integrated database retrieval system