KEGG   Homo sapiens (human): 81300Help
Entry
81300             CDS       T01001                                 

Gene name
OR4P4, OR4P3P
Definition
(RefSeq) olfactory receptor family 4 subfamily P member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81300 (OR4P4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81300 (OR4P4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 81300
NCBI-ProteinID: NP_001004124
HGNC: 15180
Ensembl: ENSG00000181927
Vega: OTTHUMG00000165300
Pharos: Q8NGL7(Tdark)
UniProt: Q8NGL7
Position
11q11
AA seq 312 aa AA seqDB search
MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFF
LNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDR
YVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVY
PLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSKALATCSS
HVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVW
CCQILLKRNQLF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagcaataatagcactttgtttattctcttggggttttcccaaaataagaac
attgaagtcctctgctttgtattatttttgttttgctacattgctatttggatgggaaac
ttactcataatgatttctatcacgtgcacccagctcattcaccaacccatgtatttcttc
ctcaattacctctcactctccgacctttgctacacatccacagtgacccccaaattaatg
gttgacttactggcagaaagaaagaccatttcctataataactgtatgatacaactcttt
accacccatttttttggaggcatagagatcttcattctcacagggatggcctatgaccgc
tatgtggccatttgcaagcccctgcactacaccattattatgagcaggcaaaagtgtaac
acaatcatcatagtttgttgtactgggggatttatacattctgccagtcagtttcttctc
accatctttgtaccattttgtggcccaaatgagatagatcactacttctgtgatgtgtat
cctttgctgaaattggcctgttctaatatacacatgataggtctcttagtcattgctaat
tcaggcttaattgctttggtgacatttgttgtcttgttgttgtcttatgtttttatattg
tataccatcagagcatactctgcagagagacgcagcaaagctcttgccacttgtagttct
catgtaattgttgtggtcctgttttttgcacctgcattgttcatttacattagaccggtc
acaacattctcagaagataaagtgtttgcccttttttataccatcattgctcccatgttc
aaccctctcatatacacgctgagaaacacagagatgaagaacgccatgaggaaagtgtgg
tgttgtcaaatactcctgaaaagaaatcaacttttctga

DBGET integrated database retrieval system