KEGG   Homo sapiens (human): 81327Help
Entry
81327             CDS       T01001                                 

Gene name
OR4A16, OR11-117, OR4A16Q
Definition
(RefSeq) olfactory receptor family 4 subfamily A member 16
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81327 (OR4A16)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81327 (OR4A16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF1641 DAD SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 81327
NCBI-ProteinID: NP_001005274
HGNC: 15153
Ensembl: ENSG00000181961
Vega: OTTHUMG00000166710
Pharos: Q8NH70(Tdark)
UniProt: Q8NH70 A0A126GW87
Position
11q11
AA seq 328 aa AA seqDB search
MRPSSNVTEFVLLGLTQDPDVKKTLFVMFLLIYIVTMVGNLLIWVTTIGSPSLGSLMYFF
LAYLSLMDAIYSTAMSPKLMIDLLCDKIAISLSACMGQLFIEHLLGGAEVFLLVVMAYDR
YVAISKPLHYLNIMNRLVCILLLVVAMIGGFVHSVVQIVFLYSLPICGPNVIDHSVCDMY
PLLELLCLDTYFIGLTVVANGGIICMVIFTFLLISCGVILNFLKTYSQEERHKALPTCIS
HIIVVALVFVPCIFMYVRPVSNFPFDKLMTVFYSIITLMLNPLIYSLRQSEMKNAMKNLW
CEKLSIVRKRVSPTLNIFIPSSKATNRR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagaccaagcagcaatgttacagaatttgtcctcctgggcctcactcaagatcctgat
gtgaaaaaaacattatttgtcatgtttttactcatatacattgtgacaatggtgggaaac
ctcctcatttgggtgactactattggcagcccctccttgggctccctaatgtacttcttc
cttgcctacttgtcacttatggatgccatatattccactgccatgtcacccaaattgatg
atagacttactctgtgataaaatcgctatttccttgtcagcttgcatgggtcagctcttc
atagaacacttacttggtggtgcagaggtcttccttttggtggtgatggcctatgatcgc
tatgtggctatctctaagccgctgcactatttgaacatcatgaatcgactggtttgcatc
cttctgttggtggtggccatgattggaggttttgtgcactctgtggttcaaattgtcttt
ctgtacagtctaccaatctgtggccccaatgttattgaccactctgtctgtgacatgtac
ccattgttggaactgttgtgccttgacacctactttataggactcactgtggttgccaat
ggtggaataatttgtatggtcatctttacctttctgctaatctcctgtggagtcatccta
aacttccttaaaacttacagtcaggaagagaggcataaagccctgcctacctgcatctcc
cacatcattgtggttgccctcgtttttgttccctgtatttttatgtatgttagacccgtt
tccaactttccctttgataaattaatgactgtgttttattcaattatcacactcatgttg
aatcctttaatatactcgttgagacaatcagagatgaaaaatgctatgaaaaatctctgg
tgtgaaaagttaagtatagttagaaaaagagtatctcccacactgaacatatttattcct
agttctaaggcaacaaataggcggtaa

DBGET integrated database retrieval system