KEGG   Homo sapiens (human): 81341Help
Entry
81341             CDS       T01001                                 

Gene name
OR10W1, OR10W1P, OR10W1Q, OR11-236, UNQ6469
Definition
(RefSeq) olfactory receptor family 10 subfamily W member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81341 (OR10W1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81341 (OR10W1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 81341
NCBI-ProteinID: NP_997257
HGNC: 15139
Ensembl: ENSG00000172772
Vega: OTTHUMG00000167462
Pharos: Q8NGF6(Tdark)
UniProt: Q8NGF6
Position
11q12.1
AA seq 305 aa AA seqDB search
MEFVFLAYPSCPELHILSFLGVSLVYGLIITGNILIVVSIHTETCLCTSMYYFLGSLSGI
EICYTAVVVPHILANTLQSEKTITLLGCATQMAFFIALGSADCFLLAAMAYDRYVAICHP
LQYPLLMTLTLCVHLVVASVISGLFLSLQLVAFIFSLPFCQAQGIEHFFCDVPPVMHVVC
AQSHIHEQSVLVAAILAIAVPFFLITTSYTFIVAALLKIHSAAGRHRAFSTCSSHLTVVL
LQYGCCAFMYLCPSSSYNPKQDRFISLVYTLGTPLLNPLIYALRNSEMKGAVGRVLTRNC
LSQNS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgtgttcctggcctatccctcctgcccagaactgcatattctgtccttcctt
ggggtcagcctggtttatggtttgatcatcactgggaacattctcattgtggtgtccatt
cacacagaaacctgtctatgcacatccatgtactatttcctgggcagcctttctgggatt
gaaatatgctacactgcagtggtggtgccccatatcctggccaacaccctacagtcagag
aagaccatcactctcctgggctgtgccacccagatggctttcttcattgcactgggcagt
gctgattgcttcctcttggctgccatggcctatgaccgctatgtggccatttgccacccg
ttgcagtaccctctcctcatgacattgactctttgtgtccacttggttgtggcatcagtc
atcagtggtctgttcctgtccttacaactggtggccttcatcttctctctgccattctgc
caggctcagggcattgagcacttcttttgtgatgtgccaccagtcatgcatgttgtttgt
gctcagagtcacattcatgagcagtcagtgctggtggcagccatactagccattgctgtg
cctttcttcctcatcaccacctcctacaccttcatagtggctgctctgctcaagatccac
tcggctgctggccgccaccgggccttctccacctgctcttcccacctcactgtggtgctg
ctgcagtatggctgctgtgccttcatgtacctgtgccccagctccagctacaaccccaag
caagatcggttcatctcactggtgtacacattgggaaccccactgctcaacccacttatc
tatgccctgaggaacagtgagatgaaaggggccgtagggagagttcttaccaggaactgc
ctttcccagaacagctag

DBGET integrated database retrieval system