KEGG   Homo sapiens (human): 81392Help
Entry
81392             CDS       T01001                                 

Gene name
OR2AE1, OR2AE2
Definition
olfactory receptor, family 2, subfamily AE, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 323 aa AA seqDB search
MWQKNQTSLADFILEGLFDDSLTHLFLFSLTMVVFLIAVSGNTLTILLICIDPQLHTPMY
FLLSQLSLMDLMHVSTIILKMATNYLSGKKSISFVGCATQHFLYLCLGGAECFLLAVMSY
DRYVAICHPLRYAVLMNKKVGLMMAVMSWLGASVNSLIHMAILMHFPFCGPRKVYHFYCE
FPAVVKLVCGDITVYETTVYISSILLLLPIFLISTSYVFILQSVIQMRSSGSKRNAFATC
GSHLTVVSLWFGACIFSYMRPRSQCTLLQNKVGSVFYSIITPTLNSLIYTLRNKDVAKAL
RRVLRRDVITQCIQRLQLWLPRV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagaagaatcagacctctctggcagacttcatccttgaggggctcttcgatgac
tcccttacccaccttttccttttctccttgaccatggtggtcttccttattgcggtgagt
ggcaacaccctcaccattctcctcatctgcattgatccccagcttcatacaccaatgtat
ttcctgctcagccagctctccctcatggatctgatgcatgtctccacaatcatcctgaag
atggctaccaactacctatctggcaagaaatctatctcctttgtgggctgtgcaacccag
cacttcctctatttgtgtctaggtggtgctgaatgttttctcttagctgtcatgtcctat
gaccgctatgttgccatctgtcatccactgcgctatgctgtgctcatgaacaagaaggtg
ggactgatgatggctgtcatgtcatggttgggggcatccgtgaactccctaattcacatg
gcgatcttgatgcacttccctttctgtgggcctcggaaagtctaccacttctactgtgag
ttcccagctgttgtgaagttggtatgtggcgacatcactgtgtatgagaccacagtgtac
atcagcagcattctcctcctcctccccatcttcctgatttctacatcctatgtcttcatc
cttcaaagtgtcattcagatgcgctcatctgggagcaagagaaatgcctttgccacttgt
ggctcccacctcacggtggtttctctttggtttggtgcctgcatcttctcctacatgaga
cccaggtcccagtgcactctattgcagaacaaagttggttctgtgttctacagcatcatt
acgcccacattgaattctctgatttatactctccggaataaagatgtagctaaggctctg
agaagagtgctgaggagagatgttatcacccagtgcattcaacgactgcaattgtggttg
ccccgagtgtag

DBGET integrated database retrieval system