KEGG   Homo sapiens (human): 814Help
Entry
814               CDS       T01001                                 

Gene name
CAMK4, CaMK_IV, CaMK-GR, IV, caMK
Definition
calcium/calmodulin-dependent protein kinase IV (EC:2.7.11.17)
Orthology
K05869  
calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Osteoclast differentiation
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    814 (CAMK4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    814 (CAMK4)
  Nervous system
   04725 Cholinergic synapse
    814 (CAMK4)
   04720 Long-term potentiation
    814 (CAMK4)
   04722 Neurotrophin signaling pathway
    814 (CAMK4)
  Development
   04380 Osteoclast differentiation
    814 (CAMK4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    814 (CAMK4)
   05034 Alcoholism
    814 (CAMK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     814 (CAMK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK1 family [OT]
   814 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q21.3
AA seq 473 aa AA seqDB search
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtcaccgccagt
gcggccccggggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgccgttaaacaaatcctggaggcagttgcttatctacatgaaaatgggatt
gtccatcgtgatctcaaaccagagaatcttctttatgcaactccagccccagatgcacca
ctcaaaatcgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaaagaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatccaaagaaacggctgactacatttcaagctctccagcatccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcaaaagaagctccaagaattc
aatgcccggcgtaagcttaaggcagcggtgaaggctgtggtggcctcttcccgcctggga
agtgccagcagcagccatggcagcatccaggagagccacaaggctagccgagacccttct
ccaatccaagatggcaacgaggacatgaaagctattccagaaggagagaaaattcaaggc
gatggggcccaagccgcagttaagggggcacaggctgagctgatgaaggtgcaagcctta
gagaaagttaaaggtgcagatataaatgctgaagaggcccccaaaatggtgcccaaggca
gtggaggatgggataaaggtggctgacctggaactagaggagggcctagcagaggagaag
ctgaagactgtggaggaggcagcagctcccagagaagggcaaggaagctctgctgtgggt
tttgaagttccacagcaagatgtgatcctgccagagtactaa

KEGG   Homo sapiens (human): 815Help
Entry
815               CDS       T01001                                 

Gene name
CAMK2A, CAMKA
Definition
calcium/calmodulin-dependent protein kinase II alpha (EC:2.7.11.17)
Orthology
K04515  
calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Wnt signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Amphetamine addiction
Tuberculosis
Proteoglycans in cancer
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    815 (CAMK2A)
   04310 Wnt signaling pathway
    815 (CAMK2A)
   04066 HIF-1 signaling pathway
    815 (CAMK2A)
   04020 Calcium signaling pathway
    815 (CAMK2A)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    815 (CAMK2A)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    815 (CAMK2A)
   04912 GnRH signaling pathway
    815 (CAMK2A)
   04921 Oxytocin signaling pathway
    815 (CAMK2A)
   04916 Melanogenesis
    815 (CAMK2A)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    815 (CAMK2A)
  Digestive system
   04971 Gastric acid secretion
    815 (CAMK2A)
  Nervous system
   04725 Cholinergic synapse
    815 (CAMK2A)
   04728 Dopaminergic synapse
    815 (CAMK2A)
   04720 Long-term potentiation
    815 (CAMK2A)
   04722 Neurotrophin signaling pathway
    815 (CAMK2A)
  Sensory system
   04740 Olfactory transduction
    815 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    815 (CAMK2A)
  Environmental adaptation
   04713 Circadian entrainment
    815 (CAMK2A)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    815 (CAMK2A)
   05214 Glioma
    815 (CAMK2A)
  Substance dependence
   05031 Amphetamine addiction
    815 (CAMK2A)
  Infectious diseases
   05152 Tuberculosis
    815 (CAMK2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     815 (CAMK2A)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK2 family
   815 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q32
AA seq 489 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagccttctcggtggtgcgaaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacacaaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacatcgtccgactacatgacagcatctca
gaggagggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatatctc
tccccagaagtgctgcggaaggacccgtacgggaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccgttctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagccggcgcctatgatttcccatcgccggaatgggacactgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcatcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctccggagggaagagtggggga
aacaagaagagcgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacagccttcgaacctgaggccctggggaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgctggcggcatcccacgcaccgcccagtcg
gaggagacccgtgtctggcaccgccgggatggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Homo sapiens (human): 816Help
Entry
816               CDS       T01001                                 

Gene name
CAMK2B, CAM2, CAMK2, CAMKB
Definition
calcium/calmodulin-dependent protein kinase II beta (EC:2.7.11.17)
Orthology
K04515  
calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Wnt signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Amphetamine addiction
Tuberculosis
Proteoglycans in cancer
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    816 (CAMK2B)
   04310 Wnt signaling pathway
    816 (CAMK2B)
   04066 HIF-1 signaling pathway
    816 (CAMK2B)
   04020 Calcium signaling pathway
    816 (CAMK2B)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    816 (CAMK2B)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    816 (CAMK2B)
   04912 GnRH signaling pathway
    816 (CAMK2B)
   04921 Oxytocin signaling pathway
    816 (CAMK2B)
   04916 Melanogenesis
    816 (CAMK2B)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    816 (CAMK2B)
  Digestive system
   04971 Gastric acid secretion
    816 (CAMK2B)
  Nervous system
   04725 Cholinergic synapse
    816 (CAMK2B)
   04728 Dopaminergic synapse
    816 (CAMK2B)
   04720 Long-term potentiation
    816 (CAMK2B)
   04722 Neurotrophin signaling pathway
    816 (CAMK2B)
  Sensory system
   04740 Olfactory transduction
    816 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    816 (CAMK2B)
  Environmental adaptation
   04713 Circadian entrainment
    816 (CAMK2B)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    816 (CAMK2B)
   05214 Glioma
    816 (CAMK2B)
  Substance dependence
   05031 Amphetamine addiction
    816 (CAMK2B)
  Infectious diseases
   05152 Tuberculosis
    816 (CAMK2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     816 (CAMK2B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK2 family
   816 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3-p14.1
AA seq 666 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcagccagagatcaccagaagctggagaga
gaggctcggatctgccgccttctgaagcattccaacatcgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagcgaggctgatgccagtcactgtatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgcttctggccagcaagtgcaaaggggctgcagtgaagctggcagacttcggccta
gctatcgaggtgcagggggaccagcaggcatggtttggtttcgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcgtatggcaagcctgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggctggtgcctatgacttcccgtcccctgagtgggacacc
gtcactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgctccacggtagcatcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccaggagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagccgccaccagccccaaagggacgcttcctcctgccgccctggagcctcaa
accaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaatacc
accatagaggatgaagacgctaaagcccccagggtccccgacatcctgagctcagtgagg
aggggctcgggagccccagaagccgaggggcccctgccctgcccatctccggctcccttt
agccccctgccagccccatcccccaggatctctgacatcctgaactctgtgagaaggggt
tcaggaaccccagaagccgagggccccctctcagcggggcccccgccctgcctgtctccg
gctctcctaggccccctgtcctccccgtcccccaggatctctgacatcctgaactctgtg
aggaggggctcagggaccccagaagccgagggcccctcgccagtggggcccccgccctgc
ccatctccgactatccctggccccctgcccaccccatcccggaagcaggagatcattaag
accacggagcagctcatcgaggccgtcaacaacggtgactttgaggcctacgcgaaaatc
tgtgacccagggctgacctcgtttgagcctgaagcactgggcaacctggttgaagggatg
gacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccacacg
accatcctgaacccacacgtgcacgtcattggagaggatgccgcctgcatcgcttacatc
cggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgaggagacc
cgcgtgtggcaccgccgcgacggcaagtggcagaacgtgcacttccactgctcgggcgcg
cctgtggccccgctgcagtga

KEGG   Homo sapiens (human): 817Help
Entry
817               CDS       T01001                                 

Gene name
CAMK2D, CAMKD
Definition
calcium/calmodulin-dependent protein kinase II delta (EC:2.7.11.17)
Orthology
K04515  
calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Wnt signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Amphetamine addiction
Tuberculosis
Proteoglycans in cancer
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    817 (CAMK2D)
   04310 Wnt signaling pathway
    817 (CAMK2D)
   04066 HIF-1 signaling pathway
    817 (CAMK2D)
   04020 Calcium signaling pathway
    817 (CAMK2D)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    817 (CAMK2D)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    817 (CAMK2D)
   04912 GnRH signaling pathway
    817 (CAMK2D)
   04921 Oxytocin signaling pathway
    817 (CAMK2D)
   04916 Melanogenesis
    817 (CAMK2D)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    817 (CAMK2D)
  Digestive system
   04971 Gastric acid secretion
    817 (CAMK2D)
  Nervous system
   04725 Cholinergic synapse
    817 (CAMK2D)
   04728 Dopaminergic synapse
    817 (CAMK2D)
   04720 Long-term potentiation
    817 (CAMK2D)
   04722 Neurotrophin signaling pathway
    817 (CAMK2D)
  Sensory system
   04740 Olfactory transduction
    817 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    817 (CAMK2D)
  Environmental adaptation
   04713 Circadian entrainment
    817 (CAMK2D)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    817 (CAMK2D)
   05214 Glioma
    817 (CAMK2D)
  Substance dependence
   05031 Amphetamine addiction
    817 (CAMK2D)
  Infectious diseases
   05152 Tuberculosis
    817 (CAMK2D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     817 (CAMK2D)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK2 family
   817 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q26
AA seq 499 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENFSGGTSLWQNI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatctgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcaagagaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgttaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagaatgggacacg
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgc
atcacagcctcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaaggagtcaactgagagttcaaatacaacaattgaggat
gaagatgtgaaagcacgaaagcaagagattatcaaagtcactgaacaactgatcgaagct
atcaacaatggggactttgaagcctacacaaaaatctgtgacccaggccttactgctttt
gaacctgaagctttgggtaatttagtggaagggatggattttcaccgattctactttgaa
aatgctttgtccaaaagcaataaaccaatccacactattattctaaaccctcatgtacat
ctggtaggggatgatgccgcctgcatagcatatattaggctcacacagtacatggatggc
agtggaatgccaaagacaatgcagtcagaagagactcgtgtgtggcaccgccgggatgga
aagtggcagaatgttcattttcatcgctcggggtcaccaacagtacccatcaagccaccc
tgtattccaaatgggaaagaaaacttctcaggaggcacctctttgtggcaaaacatctaa

KEGG   Homo sapiens (human): 818Help
Entry
818               CDS       T01001                                 

Gene name
CAMK2G, CAMK, CAMK-II, CAMKG
Definition
calcium/calmodulin-dependent protein kinase II gamma (EC:2.7.11.17)
Orthology
K04515  
calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Wnt signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Amphetamine addiction
Tuberculosis
Proteoglycans in cancer
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    818 (CAMK2G)
   04310 Wnt signaling pathway
    818 (CAMK2G)
   04066 HIF-1 signaling pathway
    818 (CAMK2G)
   04020 Calcium signaling pathway
    818 (CAMK2G)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    818 (CAMK2G)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    818 (CAMK2G)
   04912 GnRH signaling pathway
    818 (CAMK2G)
   04921 Oxytocin signaling pathway
    818 (CAMK2G)
   04916 Melanogenesis
    818 (CAMK2G)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    818 (CAMK2G)
  Digestive system
   04971 Gastric acid secretion
    818 (CAMK2G)
  Nervous system
   04725 Cholinergic synapse
    818 (CAMK2G)
   04728 Dopaminergic synapse
    818 (CAMK2G)
   04720 Long-term potentiation
    818 (CAMK2G)
   04722 Neurotrophin signaling pathway
    818 (CAMK2G)
  Sensory system
   04740 Olfactory transduction
    818 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    818 (CAMK2G)
  Environmental adaptation
   04713 Circadian entrainment
    818 (CAMK2G)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    818 (CAMK2G)
   05214 Glioma
    818 (CAMK2G)
  Substance dependence
   05031 Amphetamine addiction
    818 (CAMK2G)
  Infectious diseases
   05152 Tuberculosis
    818 (CAMK2G)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     818 (CAMK2G)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK2 family
   818 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22
AA seq 539 aa AA seqDB search
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKPQSNNKNSL
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIE
AINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHV
HVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgtttcaccgacgactaccagctcttcgaggagctt
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtac
gcagcaaaaatcatcaataccaagaagttgtctgcccgggatcaccagaaactagaacgt
gaggctcggatatgtcgacttctgaaacatccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagcagatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacatcgtccacagggacctgaagcctgag
aacctgctgctggcgagtaaatgcaagggtgccgccgtcaagctggctgattttggccta
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctatcctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacg
gtaactcctgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgtcaacgatccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgtttgcgcaagttcaatgcccggagaaaactg
aagggtgccatcctcacgaccatgcttgtctccaggaacttctcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctattgaacaagaagtcggatggcggtgtcaagccacagagcaacaacaaaaacagtctc
gtaagcccagcccaagagcccgcgcccttgcagacggccatggagccacaaaccactgtg
gtacacaacgctacagatgggatcaagggctccacagagagctgcaacaccaccacagaa
gatgaggacctcaaagtgcgaaaacaggagatcattaagattacagaacagctgattgaa
gccatcaacaatggggactttgaggcctacacgaagatttgtgatccaggcctcacttcc
tttgagcctgaggcccttggtaacctcgtggaggggatggatttccataagttttacttt
gagaatctcctgtccaagaacagcaagcctatccataccaccatcctaaacccacacgtc
cacgtgattggggaggacgcagcgtgcatcgcctacatccgcctcacccagtacatcgac
gggcagggtcggcctcgcaccagccagtcagaagagacccgggtctggcaccgtcgggat
ggcaagtggctcaatgtccactatcactgctcaggggcccctgccgcaccgctgcagtga

DBGET integrated database retrieval system