KEGG   Homo sapiens (human): 81442Help
Entry
81442             CDS       T01001                                 

Gene name
OR6N2, OR1-23
Definition
(RefSeq) olfactory receptor family 6 subfamily N member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81442 (OR6N2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81442 (OR6N2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 81442
NCBI-ProteinID: NP_001005278
HGNC: 15035
Ensembl: ENSG00000188340
Vega: OTTHUMG00000022775
Pharos: Q8NGY6(Tdark)
UniProt: Q8NGY6 A0A126GV57
Position
1q23.1
AA seq 317 aa AA seqDB search
MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMY
HFVSVLSFLELWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAY
DRYLAICRPLHYPIIMTTTLCAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCD
FPPLLSLACKDTSANILVDFAINAFIILITFFFIMISYARIIGAVLKIKTASGRKKAFST
CASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKA
IKRTIFQKGDKASLAHL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatacaaccattcaagcctggctgaatttgtgttccttggctttgccagtgtg
ggctatgtcaggggctggctttttgtcctgctgctattggcatacctgttcaccatctgt
ggtaacatgctcatcttctcagtcatccgactggatgcagctctgcacacacctatgtac
cactttgtcagtgttctttccttcttggagttgtggtatacagctaccactatccctaag
atgttgtctaatattctcagtgagaagaaaaccatttcttttgcaggatgcctccttcag
acctacttcttccactccttgggagcgtctgaatgctaccttcttacagccatggcctat
gatagatacctggccatttgtcggcccctccactaccctataattatgaccaccacactc
tgtgccaagatggctgctgcttgttggacttgtggcttcctgtgtcccatttctgaggtc
atccttgcctcccagctcccattttgtgcttacaatgaaatccaacacattttctgtgac
tttccacctttgctgagcttggcctgcaaggacacatctgctaacattctggtggacttt
gccattaatgctttcataattcttatcactttcttctttatcatgatttcttatgcaagg
atcattggggctgtgctgaagataaaaacagcatcaggaagaaagaaggccttttctacc
tgtgcctcacatcttgctgtggtcctcatcttctttgggagcatcatcttcatgtatgtg
cggctaaagaagagctattccctgacccttgaccgaacacttgctatagtttactccgta
ctaacaccaatggtcaatccaattatctacagtcttcgtaacaaggaaatcattaaagct
atcaagaggaccatcttccagaagggagataaagctagtcttgctcatctttga

DBGET integrated database retrieval system