KEGG   Homo sapiens (human): 81448Help
Entry
81448             CDS       T01001                                 

Gene name
OR6K2, OR1-17
Definition
olfactory receptor, family 6, subfamily K, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81448 (OR6K2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81448 (OR6K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.1
AA seq 324 aa AA seqDB search
MESPNRTTIQEFIFSAFPYSWVKSVVCFVPLLFIYAFIVVGNLVIITVVQLNTHLHTPMY
TFISALSFLEIWYTTATIPKMLSSLLSERSISFNGCLLQMYFFHSTGICEVCLLTVMAFD
HYLAICSPLHYPSIMTPKLCTQLTLSCCVCGFITPLPEIAWISTLPFCGSNHLEHIFCDF
LPVLRLACTDTRAIVMIQVVDVIHAVEIITAVMLIFMSYDGIVAVILRIHSAGGRRTAFS
TCVSHFIVFSLFFGSVTLMYLRFSATYSLFWDIAIALAFAVLSPFFNPIIYSLRNKEIKE
AIKKHIGQAKIFFSVRPGTSSKIF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagagccccaatcgaaccaccattcaggagtttatcttctccgctttcccttattcc
tgggttaagtctgttgtctgctttgttccactgctcttcatctatgctttcattgttgtt
ggaaacctggtcatcatcacagtggtccagttgaatactcacctccacactcccatgtat
acttttatcagtgctctttctttcctggagatttggtataccacagccacaatcccaaag
atgctgtctagcctgcttagtgagaggagcatttccttcaatggttgtctcctgcagatg
tatttcttccattccaccggcatctgtgaggtgtgtctcttgacagttatggcctttgac
cactacctggccatatgcagccctcttcattatccctctatcatgacccccaagctatgt
acccaactgactttaagttgctgtgtttgtggctttatcacaccccttcctgagattgcc
tggatctctacactgccattttgtggttcgaatcaccttgaacatatcttctgtgacttc
ctcccagtgctgcgtctggcctgcacagacacacgagccatcgtcatgattcaggtagtg
gatgtcattcatgcagtggagattattacagctgtgatgctcatcttcatgtcctacgat
ggtattgtggctgtaattctacgtattcattcagctggaggccgccgcacagcattttcc
acgtgtgtctctcacttcattgtcttttcgctcttctttggcagtgtgactctcatgtac
ctacgcttctctgccacctactctttgttctgggatatagccattgctctggcctttgca
gttttgtctcccttcttcaaccccattatctatagcctgaggaataaagaaataaaagaa
gctataaaaaagcacataggtcaagctaagatatttttttccgtaagaccagggacctca
agtaagatattttag

DBGET integrated database retrieval system