KEGG   Homo sapiens (human): 81466Help
Entry
81466             CDS       T01001                                 

Gene name
OR2L5, OR2L11, OR2L5P
Definition
(RefSeq) olfactory receptor family 2 subfamily L member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81466 (OR2L5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81466 (OR2L5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 81466
NCBI-ProteinID: NP_001245213
HGNC: 15011
Ensembl: ENSG00000197454
Vega: OTTHUMG00000040194
Pharos: Q8NG80(Tdark)
UniProt: Q8NG80 A0A126GWR8
Position
1q44
AA seq 312 aa AA seqDB search
MENYNQTSTDFILLGLFPPSKIGLFLFILFVLIFLMALIGNLSMILLIFLDTHLHTPMYF
LLSQLSLIDLNYISTIVPKMASDFLYGNKSISFIGCGIQSFFFMTFAGAEALLLTSMAYD
RYVAICFPLHYPIRMSKRMYVLMITGSWMIGSINSCAHTVYAFRIPYCKSRAINHFFCDV
PAMLTLACTDTWVYEYTVFLSSTIFLVFPFTGIACSYGWVLLAVYRMHSAEGRKKAYSTC
STHLTVVTFYYAPFAYTYLCPRSLRSLTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGAL
TRVIQNIFSVKM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattacaatcaaacgtcaactgatttcatcttattggggctgttcccaccatca
aaaattggccttttcctcttcattctctttgttctcattttcctaatggctctaattgga
aacctatccatgattcttctcatcttcttggacacccatctccacacacccatgtatttc
ctgcttagtcagctctccctcattgacctaaattacatctctacgattgttcctaagatg
gcttctgattttctgtatggaaacaagtctatctccttcattgggtgtgggattcagagt
ttcttcttcatgacttttgcaggtgcagaagcgctgctcctgacatcaatggcctatgat
cgttatgtggccatttgctttcctctccactatcccatccgtatgagcaaaagaatgtat
gtgctgatgataacaggatcttggatgataggctccatcaactcttgtgctcacacagta
tatgcattccgtatcccatattgcaagtccagagccatcaatcattttttctgtgatgtt
ccagctatgttgacattagcctgtacagacacctgggtctatgagtacacagtgtttttg
agcagcaccatctttcttgtgtttcccttcactggcattgcgtgttcctatggctgggtt
ctccttgctgtctaccgcatgcactctgcagaagggaggaaaaaggcctattcgacctgc
agcacccacctcactgtagtaactttctactatgcaccctttgcttatacctatctatgt
ccaagatccctgcgatctctgacagaggacaaggttctggctgttttctacaccatcctc
accccaatgctcaaccccatcatctacagcctgagaaacaaggaggtgatgggggccctg
acacgagtgattcagaatatcttctcggtgaaaatgtag

DBGET integrated database retrieval system