KEGG   Homo sapiens (human): 81469Help
Entry
81469             CDS       T01001                                 

Gene name
OR2G3, OR1-33
Definition
(RefSeq) olfactory receptor family 2 subfamily G member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81469 (OR2G3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81469 (OR2G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 81469
NCBI-ProteinID: NP_001001914
HGNC: 15008
Ensembl: ENSG00000177476
Vega: OTTHUMG00000040576
Pharos: Q8NGZ4(Tdark)
UniProt: Q8NGZ4 A0A126GVX0
Position
1q44
AA seq 309 aa AA seqDB search
MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMY
FFLSNLSLLDICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMAL
DRYIAVCKPLHYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICE
VPALLKLACVDTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFST
CSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEA
LRKLLSGKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggattgggcaatgagagttccctaatggatttcatccttctaggcttctcagaccac
cctcgtctggaggctgttctctttgtatttgtccttttcttctacctcctgacccttgtg
ggaaacttcaccataatcatcatctcatatctggatccccctcttcataccccaatgtac
ttttttctcagcaacctctctttactggacatctgcttcactactagccttgctcctcag
accttagttaacttgcaaagaccaaagaagacgatcacttacggtggttgtgtggcgcaa
ctctatatttctctggcactgggctccactgaatgtatcctcttggctgacatggccttg
gatcggtacattgctgtctgcaaacccctccactatgtagtcatcatgaacccacggctt
tgccaacagctggcatctatctcctggctcagtggtttggctagttccctaatccatgca
acttttaccttgcaattgcctctctgtggcaaccataggctggaccattttatttgcgaa
gtaccagctcttctcaagttggcttgtgtggacaccactgtcaatgaattggtgcttttt
gttgttagtgttctgtttgttgtcattccaccagcactcatctccatctcctatggcttc
ataactcaagctgtgctgaggatcaaatcagtagaggcaaggcacaaagccttcagcacc
tgctcctcccaccttacagtggtgattatattctatggcaccataatctacgtgtacctg
caacctagtgacagctatgcccaggaccaagggaagtttatctccctcttctacaccatg
gtgacccccactttaaatcctatcatctatactttaaggaacaaggatatgaaagaggct
ctgaggaaacttctctcgggaaaattgtga

DBGET integrated database retrieval system