KEGG   Homo sapiens (human): 8148Help
Entry
8148              CDS       T01001                                 

Gene name
TAF15, Npl3, RBP56, TAF2N, TAFII68
Definition
TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Orthology
K14651  
transcription initiation factor TFIID subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Transcriptional misregulation in cancer
Disease
H00053  
Extraskeletal myxoid chondrosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    8148 (TAF15)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8148 (TAF15)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     8148 (TAF15)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     8148 (TAF15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.1-q11.2
AA seq 589 aa AA seqDB search
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSY
SQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYD
QHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGG
GRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGE
GVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWF
DGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNP
SCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRS
GGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDR
GGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGG
DRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattctggaagttacggtcagtctgggggtgagcagcaaagttattctacctat
ggaaatccaggcagccaaggctatggacaagcatcacaaagctattctggctatgggcaa
acgactgattcctcttatggacagaactacagcggttactccagttatggacaaagttat
tcacagtcctatggtggttatgagaatcaaaagcagagctcatatagccagcaaccatat
aataaccagggacagcagcaaaacatggaatcatcaggaagccaaggtggaagagcacct
tcctatgaccagccagactatggtcaacaagattcatatgaccagcagtcaggctatgat
caacatcaaggctcatatgatgagcagtcaaattatgatcagcagcatgattcctatagt
caaaaccagcagtcctatcattcacaaagggaaaactacagccaccacacacaagatgac
cgtcgtgatgtgagtaggtatggagaagataatagaggatatggcgggtcacagggagga
ggtagagggcgtgggggatatgacaaggatggaagaggtcctatgacaggatcaagtggt
ggtgaccgcggtggcttcaaaaattttggtggtcacagggattatggacccagaacagat
gctgattcagaatctgataattcagataacaacacaatctttgtgcaaggacttggggag
ggtgtgtctacagatcaagttggggagttctttaaacaaataggaattatcaagacaaat
aagaagaccggaaaaccaatgataaatctttatacagacaaggacacaggaaagccaaag
ggggaggcaacagtgtcatttgatgaccctccttcagctaaggcagccattgactggttt
gatggaaaagaattccatggcaacatcattaaagtgtcctttgccactagaagacctgaa
ttcatgagaggaggtggaagtggaggtgggcggcgaggccgtggaggatatagaggtcgt
ggaggctttcaagggagaggtggagaccccaaaagtggggattgggtttgccctaatccg
tcatgcggaaatatgaactttgctcgaaggaattcctgcaatcagtgcaatgagcctaga
ccagaggactctcgtccctcaggaggagatttccgggggagaggctacggtggagagagg
ggctacagaggtcgtgggggcagaggtggagaccgaggcggctatggtggagacagaagt
gggggtggctatggtggagacagaagcagcggtggtggctacagcggagatagaagtggg
ggcggctatggtggagacagaagtgggggtggctatggtggggacagaggcggcggctat
ggtggggacagaggaggcggctatggaggagaccgaggaggtggctatggaggagatcga
ggtggctatggaggagaccgaggtggaggctatggtggagaccgaggaggctatggagga
gatcgaggaggttacggaggagatcgaggaggttatggaggagatcgaggaggctatgga
ggagacagaagccgggggggctatggaggagaccgtggtggtggcagtggctacggtgga
gaccgaagtggaggctatggaggagacaggagtggtggcggctatggaggagaccgaggt
gggggctacggaggagaccgaggtggctatggaggcaaaatgggaggaagaaacgactac
agaaatgatcagcgcaaccgaccatactga

DBGET integrated database retrieval system