KEGG   Homo sapiens (human): 81494Help
Entry
81494             CDS       T01001                                 

Gene name
CFHR5, CFHL5, CFHR5D, FHR-5, FHR5
Definition
complement factor H-related 5
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31.3
AA seq 569 aa AA seqDB search
MLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGYSL
QNNEKNISCVERGWSTPPICSFTKGECHVPILEANVDAQPKKESYKVGDVLKFSCRKNLI
RVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNGEVKEIRKEEYGHNEVVEYDCNPN
FIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELEYGYVQPSVPPYQHGVSVEVNCRNE
YAMIGNNMITCINGIWTELPMCVATHQLKRCKIAGVNIKTLLKLSGKEFNHNSRIRYRCS
DIFRYRHSVCINGKWNPEVDCTEKREQFCPPPPQIPNAQNMTTTVNYQDGEKVAVLCKEN
YLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINNGDTTSFPLSVYPPGSTVTYRCQS
FYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQ
CKFPHKAMISSPPFRAICQEGKFEYPICE
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcttattcagtgtaatcctaatctcatgggtatccactgttgggggagaagga
acactttgtgattttccaaaaatacaccatggatttctgtatgatgaagaagattataac
cctttttcccaagttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatccttttggactcgcataacatgcacagaagaaggatggtcaccaaca
ccgaagtgtctcagaatgtgttcctttccttttgtgaaaaatggtcattctgaatcttca
ggactaatacatctggaaggtgatactgtacaaattatttgcaacacaggatacagcctt
caaaacaatgagaaaaacatttcgtgtgtagaacggggctggtccactcctcccatatgc
agcttcactaaaggagaatgtcatgttccaattttagaagccaatgtagatgctcagcca
aaaaaagaaagctacaaagttggagacgtgttgaaattctcctgcagaaaaaatcttata
agagttggatcagactcagttcaatgttaccaatttgggtggtcacctaactttccaaca
tgcaaaggacaagtacgatcatgtggtccacctcctcaactctccaatggtgaagttaag
gagataagaaaagaggaatatggacacaatgaagtagtggaatatgattgcaatcctaat
tttataataaacgggcctaagaaaatacaatgtgtggatggagaatggacaactttaccc
acttgtgttgaacaagtgaaaacatgtggatacatacctgaactcgagtacggttatgtt
cagccgtctgtccctccctatcaacatggagtttcagtcgaggtgaattgcagaaatgaa
tatgcaatgattggaaataacatgattacctgtattaatggaatatggacagagcttcct
atgtgtgttgcaacacaccaacttaagaggtgcaaaatagcaggagttaatataaaaaca
ttactcaagctatctgggaaagaatttaatcataattctagaatacgttacagatgttca
gacatcttcagatacaggcactcagtctgtataaacgggaaatggaatcctgaagtagac
tgcacagaaaaaagggaacaattctgcccaccgccacctcagatacctaatgctcagaat
atgacaaccacagtgaattatcaggatggagaaaaagtagctgttctctgtaaagaaaac
tatctacttccagaagcaaaagaaattgtatgtaaagatggacgatggcaatcattacca
cgctgtgttgagtctactgcatattgtgggccccctccatctattaacaatggagatacc
acctcattcccattatcagtatatcctccagggtcaacagtgacgtaccgttgccagtcc
ttctataaactccagggctctgtaactgtaacatgcagaaataaacagtggtcagaacca
ccaagatgcctagatccatgtgtggtatctgaagaaaacatgaacaaaaataacatacag
ttaaaatggagaaacgatggaaaactctatgcaaaaacaggggatgctgttgaattccag
tgtaaattcccacataaagcgatgatatcatcaccaccatttcgagcaatctgtcaggaa
gggaaatttgaatatcctatatgtgaatga

DBGET integrated database retrieval system