KEGG   Homo sapiens (human): 81539Help
Entry
81539             CDS       T01001                                 

Gene name
SLC38A1, ATA1, NAT2, SAT1, SNAT1
Definition
solute carrier family 38, member 1
Orthology
K14990  
solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    81539 (SLC38A1)
   04727 GABAergic synapse
    81539 (SLC38A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13.11
AA seq 487 aa AA seqDB search
MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFL
MGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK
DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatttcaaaagtggactcgaattaactgagttgcaaaacatgacagtgcccgag
gatgataacattagcaatgactccaatgatttcaccgaagtagaaaatggtcagataaat
agcaagtttatttctgatcgtgaaagtagaagaagtctcacaaacagccatttggaaaaa
aagaagtgtgatgagtatattccaggtacaacctccttaggcatgtctgtttttaaccta
agcaacgccattatgggcagtgggattttgggactcgcctttgccctggcaaacactgga
atcctactttttctggtacttttgacttcagtgacattgctgtctatatattcaataaac
ctcctattgatctgttcaaaagaaacaggctgcatggtgtatgaaaagctgggggaacaa
gtctttggcaccacagggaagttcgtaatctttggagccacctctctacagaacactgga
gcaatgctgagctacctcttcatcgtaaaaaatgaactaccctctgccataaagtttcta
atgggaaaggaagagacattttcagcctggtacgtggatggccgcgttctggtggtgata
gttacctttggcataattctccctctgtgtctcttgaagaacttagggtatcttggctat
actagtggattttccttgagctgtatggtttttttcctaattgtggttatttacaagaaa
tttcaaattccctgcattgttccagagctaaattcaacaataagtgctaattcaacaaat
gctgacacgtgtacgccaaaatatgttaccttcaattcaaagaccgtgtatgctttaccc
accattgcatttgcatttgtttgccacccgtcagtcctgccaatttacagtgagcttaaa
gaccgatcacagaaaaaaatgcagatggtttcaaacatctcctttttcgccatgtttgtt
atgtacttcttgactgccatttttggctacttgacattctatgacaacgtgcagtccgac
ctccttcacaaatatcagagtaaagatgacattctcatcctgacagtgcggctggctgtc
attgttgctgtgatcctcacagtgccggtgttatttttcacggttcgttcatctttattt
gaactggctaagaaaacaaagtttaatttatgtcgtcataccgtggttacctgcatactc
ttggttgttatcaacttgttggtgatcttcataccctccatgaaggatatttttggagtc
gtaggagttacatctgctaacatgcttattttcattcttccttcatctctttatttaaaa
atcacagaccaggatggagataaaggaactcaaagaatttgggctgcccttttcttgggc
ctgggggtgttgttctccttggtcagcattcccttggtcatctatgactgggcctgctca
tcgagtagtgacgaaggccactga

DBGET integrated database retrieval system