KEGG   Homo sapiens (human): 81563Help
Entry
81563             CDS       T01001                                 

Gene name
C1orf21, PIG13
Definition
(RefSeq) chromosome 1 open reading frame 21
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25
AA seq 121 aa AA seqDB search
MGCASAKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQ
ENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEEDI
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgcctccgccaagcatgttgccactgttcaaaatgaagaggaagcccagaaa
gggaaaaactaccagaacggagatgtgtttggcgatgagtataggatcaaaccagtggaa
gaggtcaaatacatgaaaaatggggcagaagaagagcagaaaatagcagccaggaaccaa
gaaaacttggaaaaaagtgccagctcaaatgtaagacttaaaactaataaagaggttccg
ggattagttcatcaacccagagcaaacatgcacatctctgaaagccaacaagaattcttc
agaatgctggatgaaaaaattgaaaagggtcgggattactgttcggaagaagaggatatc
acatag

DBGET integrated database retrieval system