KEGG   Homo sapiens (human): 81563Help
Entry
81563             CDS       T01001                                 

Gene name
C1orf21, PIG13
Definition
(RefSeq) chromosome 1 open reading frame 21
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4612 tRNA-synt_1e Transposase_24
Motif
Other DBs
NCBI-GeneID: 81563
NCBI-ProteinID: NP_110433
HGNC: 15494
Ensembl: ENSG00000116667
Vega: OTTHUMG00000035386
Pharos: Q9H246(Tdark)
UniProt: Q9H246 A0A024R926
Position
1q25.3
AA seq 121 aa AA seqDB search
MGCASAKHVATVQNEEEAQKGKNYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQ
ENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEEDI
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgcctccgccaagcatgttgccactgttcaaaatgaagaggaagcccagaaa
gggaaaaactaccagaacggagatgtgtttggcgatgagtataggatcaaaccagtggaa
gaggtcaaatacatgaaaaatggggcagaagaagagcagaaaatagcagccaggaaccaa
gaaaacttggaaaaaagtgccagctcaaatgtaagacttaaaactaataaagaggttccg
ggattagttcatcaacccagagcaaacatgcacatctctgaaagccaacaagaattcttc
agaatgctggatgaaaaaattgaaaagggtcgggattactgttcggaagaagaggatatc
acatag

DBGET integrated database retrieval system