KEGG   Homo sapiens (human): 81567Help
Entry
81567             CDS       T01001                                 

Gene name
TXNDC5, ENDOPDI, ERP46, HCC-2, HCC2, PDIA15, STRF8, UNQ364
Definition
(RefSeq) thioredoxin domain containing 5
  KO
K13984  
thioredoxin domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81567 (TXNDC5)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   81567 (TXNDC5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    81567 (TXNDC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NBS9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p24.3
AA seq 432 aa AA seqDB search
MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDP
HSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVD
CTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVE
PPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV
KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTW
EELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL
HRFVLSQAKDEL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcgcccaggacgcctcctcccgctgctggcccggccggcggccctgactgcg
ctgctgctgctgctgctgggccatggcggcggcgggcgctggggcgcccgggcccaggag
gcggcggcggcggcggcggacgggccccccgcggcagacggcgaggacggacaggacccg
cacagcaagcacctgtacacggccgacatgttcacgcacgggatccagagcgccgcgcac
ttcgtcatgttcttcgcgccctggtgtggacactgccagcggctgcagccgacttggaat
gacctgggagacaaatacaacagcatggaagatgccaaagtctatgtggctaaagtggac
tgcacggcccactccgacgtgtgctccgcccagggggtgcgaggataccccaccttaaag
cttttcaagccaggccaagaagctgtgaagtaccagggtcctcgggacttccagacactg
gaaaactggatgctgcagacactgaacgaggagccagtgacaccagagccggaagtggaa
ccgcccagtgcccccgagctcaagcaagggctgtatgagctctcagcaagcaactttgag
ctgcacgttgcacaaggcgaccactttatcaagttcttcgctccgtggtgtggtcactgc
aaagccctggctccaacctgggagcagctggctctgggccttgaacattccgaaactgtc
aagattggcaaggttgattgtacacagcactatgaactctgctccggaaaccaggttcgt
ggctatcccactcttctctggttccgagatgggaaaaaggtggatcagtacaagggaaag
cgggatttggagtcactgagggagtacgtggagtcgcagctgcagcgcacagagactgga
gcgacggagaccgtcacgccctcagaggccccggtgctggcagctgagcccgaggctgac
aagggcactgtgttggcactcactgaaaataacttcgatgacaccattgcagaaggaata
accttcatcaagttttatgctccatggtgtggtcattgtaagactctggctcctacttgg
gaggaactctctaaaaaggaattccctggtctggcgggggtcaagatcgccgaagtagac
tgcactgctgaacggaatatctgcagcaagtattcggtacgaggctaccccacgttattg
cttttccgaggagggaagaaagtcagtgagcacagtggaggcagagaccttgactcgtta
caccgctttgtcctgagccaagcgaaagacgaactttag

DBGET integrated database retrieval system