KEGG   Homo sapiens (human): 81605Help
Entry
81605             CDS       T01001                                 

Gene name
URM1, C9orf74
Definition
(RefSeq) ubiquitin related modifier 1
  KO
K12161  
ubiquitin related modifier 1
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    81605 (URM1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    81605 (URM1)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   81605 (URM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.11
AA seq 101 aa AA seqDB search
MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQG
DSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcccttgtcagtggaggtggagttcggaggtggtgcggagctcctgtttgac
ggtattaagaaacatcgagtcactttgcctggacaggaggaaccctgggacatccggaac
ctgctcatctggatcaagaagaatttgctaaaagagcggccagagttgttcatccaggga
gacagcgtgcggccaggaattctggtgctgattaacgatgccgactgggagctactgggt
gagctggactaccagcttcaggaccaggacagcgtcctcttcatctccactctgcacggc
ggctga

DBGET integrated database retrieval system