KEGG   Homo sapiens (human): 81605Help
Entry
81605             CDS       T01001                                 

Gene name
URM1, C9orf74
Definition
ubiquitin related modifier 1
Orthology
K12161  
ubiquitin related modifier 1
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    81605 (URM1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    81605 (URM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q34.11
AA seq 146 aa AA seqDB search
MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQG
DSVRPGILVLINDADWELLVSTLGDIPPPAPALAASVGKRWASPQAHIEWLGNPPPHSSP
TLRLLESPTPGEEGMGSWGHGSTPPS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcccttgtcagtggaggtggagttcggaggtggtgcggagctcctgtttgac
ggtattaagaaacatcgagtcactttgcctggacaggaggaaccctgggacatccggaac
ctgctcatctggatcaagaagaatttgctaaaagagcggccagagttgttcatccaggga
gacagcgtgcggccaggaattctggtgctgattaacgatgccgactgggagctactggtc
agtaccttgggggacatccctcccccagcccctgcccttgctgcttcagtgggaaagcgt
tgggcctctcctcaggcacatatagagtggctgggtaatcctccgccccactccagcccc
acactgaggctgctggagtctcccactccaggtgaggaagggatgggtagctggggacat
gggagtactcctccatcctga

DBGET integrated database retrieval system