KEGG   Homo sapiens (human): 81608Help
Entry
81608             CDS       T01001                                 

Gene name
FIP1L1, FIP1, Rhe, hFip1
Definition
(RefSeq) factor interacting with PAPOLA and CPSF1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    81608 (FIP1L1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     81608 (FIP1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 81608
NCBI-ProteinID: NP_112179
OMIM: 607686
HGNC: 19124
Ensembl: ENSG00000145216
Vega: OTTHUMG00000128701
Pharos: Q6UN15(Tbio)
UniProt: Q6UN15
Position
4q12
AA seq 594 aa AA seqDB search
MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS
ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERE
RTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETR
HKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcgaggtcgagcgcctagtgtcggagctgagcggcgggaccggaggggat
gaggaggaagagtggctctatggcggcccatgggacgtgcatgtgcacagtgatttggca
aaggacctagatgaaaatgaagttgaaaggccagaagaagaaaatgccagtgctaatcct
ccatctggaattgaagatgaaactgctgaaaatggtgtaccaaaaccgaaagtgactgag
accgaagatgatagtgatagtgacagcgatgatgatgaagatgatgttcatgtcactata
ggagacattaaaacgggagcaccacagtatgggagttatggtacagcacctgtaaatctt
aacatcaagacagggggaagagtttatggaactacagggacaaaagtcaaaggagtagac
cttgatgcacctggaagcattaatggagttccactcttagaggtagatttggattctttt
gaagataaaccatggcgtaaacctggtgctgatctttctgattattttaattatgggttt
aatgaagatacctggaaagcttactgtgaaaaacaaaagaggatacgaatgggacttgaa
gttataccagtaacctctactacaaataaaattacggccgaagactgtactatggaagtt
acaccaggtgcagagatccaagatggcagattcaatctttttaaggtacagcagggaaga
actggaaactcagagaaagaaactgcccttccatctacaaaagctgagtttacttctcct
ccttctttgttcaagactgggcttccaccgagcagaaacagcacttcttctcagtctcag
acaagtactgcctccagaaaagccaattcaagcgttgggaagtggcaggatcgatatggg
agggccgaatcacctgatctaaggagattacctggggcaattgatgttatcggtcagact
ataactatcagccgagtagaaggcaggcgacgggcaaatgagaacagcaacatacaggtc
ctttctgaaagatctgctactgaagtagacaacaattttagcaaaccacctccgtttttc
cctccaggagctcctcccactcaccttccacctcctccatttcttccacctcctccgact
gtcagcactgctccacctctgattccaccaccgggttttcctcctccaccaggcgctcca
cctccatctcttataccaacaatagaaagtggacattcctctggttatgatagtcgttct
gcacgtgcatttccatatggcaatgttgcctttccccatcttcctggttctgctccttcg
tggcctagtcttgtggacaccagcaagcagtgggactattatgccagaagagagaaagac
cgagatagagagagagacagagacagagagcgagaccgtgatcgggacagagaaagagaa
cgcaccagagagagagagagggagcgtgatcacagtcctacaccaagtgttttcaacagc
gatgaagaacgatacagatacagggaatatgcagaaagaggttatgagcgtcacagagca
agtcgagaaaaagaagaacgacatagagaaagacgacacagggagaaagaggaaaccaga
cataagtcttctcgaagtaatagtagacgtcgccatgaaagtgaagaaggagatagtcac
aggagacacaaacacaaaaaatctaaaagaagcaaagaaggaaaagaagcgggcagtgag
cctgcccctgaacaggagagcaccgaagctacacctgcagaatag

DBGET integrated database retrieval system