KEGG   Homo sapiens (human): 81616Help
Entry
81616             CDS       T01001                                 

Gene name
ACSBG2, BGR, BRGL, PRTD-NY3, PRTDNY3
Definition
acyl-CoA synthetase bubblegum family member 2 (EC:6.2.1.3)
Orthology
K15013  
long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 666 aa AA seqDB search
MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRES
VNRFGTYPALASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFI
TAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKA
IIQYRLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGV
MLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADA
LKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKK
MLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESET
ETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPII
SNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQD
PLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQ
IDHMYH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccccaaagactcaagaaggagctaaagatcttgaagtagacatgaataaa
acagaagttactcccaggctgtggaccacctgtcgagatggagaagtccttctgaggcta
tccaaacacggaccaggccatgagaccccgatgaccatccctgaattttttcgagagtca
gtcaaccgatttggaacttatccagccctcgcatccaagaatggcaaaaagtgggaaatt
ctgaatttcaaccagtactatgaggcttgtcggaaggctgcaaaatccttgatcaagctg
ggtttggagcgtttccacggagttggtatcctggggtttaactctgcagagtggtttatc
actgctgttggtgccatcctagccgggggtctttgtgttggtatttatgccaccaactct
gccgaggtttgtcaatatgtcatcactcatgccaaagtgaacatcttgctggttgagaat
gatcaacagttacagaaaatcctttcgattccacagagcagcctagagcccctaaaagcg
atcatccagtacagactgccaatgaagaagaacaacaacttgtactcttgggatgatttc
atggaacttggcagaagtatccctgacacccaactggagcaggtcatcgagagccagaag
gcgaatcaatgcgcagtgctcatctacacttcagggaccacaggcatacccaagggagtg
atgctcagtcatgacaacatcacgtggattgcaggagcagtgacaaaggactttaaactg
acagacaagcatgagacggtggttagctacctcccactcagccatattgcagcacagatg
atggacatctgggtacccataaagattggggcgctcacatactttgctcaagcagatgct
ctcaagggcaccttggtaagtactctaaaggaggtaaaacctactgtcttcattggagtg
cctcaaatttgggagaagatacatgagatggtgaagaaaaatagtgccaagtccatgggc
ttgaagaagaaggcattcgtgtgggcaagaaacattggcttcaaggtcaactcaaaaaag
atgttggggaaatataatactcccgtgagctaccgcatggctaagactctcgtgttcagc
aaagtcaagacatcccttggcttggatcactgtcactcttttatcagtgggactgcgccc
ctcaaccaagagactgccgagttctttctaagcttggacatacctataggcgagttgtat
gggttgagtgagagctcgggaccccacacgatatccaaccagaataactacaggcttcta
agctgtggcaagatcttgactgggtgtaagaatatgctgttccagcagaacaaggatggc
attggggagatctgcctctggggtaggcacatcttcatgggctatctggaaagtgagact
gaaactacagaggccatcgatgatgaaggctggctacactctggggatctgggccagctg
gacggtctgggtttcctctatgtcaccggccacatcaaagaaatccttatcactgctggt
ggtgaaaatgtgccccccattcctgttgagaccttggttaagaagaagatccccatcatc
agtaacgccatgttagtaggagataaactgaagtttctgagcatgttgctgacgctgaag
tgtgagatgaatcagatgagcggagaacctctggacaagctgaacttcgaggccatcaac
ttctgtcggggtctgggcagccaggcatccaccgtgactgagattgtgaagcagcaagac
cccctggtctacaaggccatccagcaaggcatcaatgctgtgaaccaggaagccatgaac
aatgcacagaggattgaaaagtgggtcatcttggagaaggacttttccatctatggtgga
gagctaggtccaatgatgaaacttaagagacattttgtagcccagaaatacaaaaaacaa
attgatcacatgtaccactga

DBGET integrated database retrieval system