KEGG   Homo sapiens (human): 81616Help
Entry
81616             CDS       T01001                                 

Gene name
ACSBG2, BGR, BRGL, PRTD-NY3, PRTDNY3
Definition
acyl-CoA synthetase bubblegum family member 2 (EC:6.2.1.3)
Orthology
K15013  
long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    81616 (ACSBG2)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    81616 (ACSBG2)
   00071 Fatty acid degradation
    81616 (ACSBG2)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    81616 (ACSBG2)
   03320 PPAR signaling pathway
    81616 (ACSBG2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     81616 (ACSBG2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   81616 (ACSBG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 666 aa AA seqDB search
MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRES
VNRFGTYPALASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFI
TAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKA
IIQYRLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGV
MLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADA
LKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKK
MLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESET
ETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPII
SNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQD
PLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQ
IDHMYH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccccaaagactcaagaaggagctaaagatcttgaagtagacatgaataaa
acagaagttactcccaggctgtggaccacctgtcgagatggagaagtccttctgaggcta
tccaaacacggaccaggccatgagaccccgatgaccatccctgaattttttcgagagtca
gtcaaccgatttggaacttatccagccctcgcatccaagaatggcaaaaagtgggaaatt
ctgaatttcaaccagtactatgaggcttgtcggaaggctgcaaaatccttgatcaagctg
ggtttggagcgtttccacggagttggtatcctggggtttaactctgcagagtggtttatc
actgctgttggtgccatcctagccgggggtctttgtgttggtatttatgccaccaactct
gccgaggtttgtcaatatgtcatcactcatgccaaagtgaacatcttgctggttgagaat
gatcaacagttacagaaaatcctttcgattccacagagcagcctagagcccctaaaagcg
atcatccagtacagactgccaatgaagaagaacaacaacttgtactcttgggatgatttc
atggaacttggcagaagtatccctgacacccaactggagcaggtcatcgagagccagaag
gcgaatcaatgcgcagtgctcatctacacttcagggaccacaggcatacccaagggagtg
atgctcagtcatgacaacatcacgtggattgcaggagcagtgacaaaggactttaaactg
acagacaagcatgagacggtggttagctacctcccactcagccatattgcagcacagatg
atggacatctgggtacccataaagattggggcgctcacatactttgctcaagcagatgct
ctcaagggcaccttggtaagtactctaaaggaggtaaaacctactgtcttcattggagtg
cctcaaatttgggagaagatacatgagatggtgaagaaaaatagtgccaagtccatgggc
ttgaagaagaaggcattcgtgtgggcaagaaacattggcttcaaggtcaactcaaaaaag
atgttggggaaatataatactcccgtgagctaccgcatggctaagactctcgtgttcagc
aaagtcaagacatcccttggcttggatcactgtcactcttttatcagtgggactgcgccc
ctcaaccaagagactgccgagttctttctaagcttggacatacctataggcgagttgtat
gggttgagtgagagctcgggaccccacacgatatccaaccagaataactacaggcttcta
agctgtggcaagatcttgactgggtgtaagaatatgctgttccagcagaacaaggatggc
attggggagatctgcctctggggtaggcacatcttcatgggctatctggaaagtgagact
gaaactacagaggccatcgatgatgaaggctggctacactctggggatctgggccagctg
gacggtctgggtttcctctatgtcaccggccacatcaaagaaatccttatcactgctggt
ggtgaaaatgtgccccccattcctgttgagaccttggttaagaagaagatccccatcatc
agtaacgccatgttagtaggagataaactgaagtttctgagcatgttgctgacgctgaag
tgtgagatgaatcagatgagcggagaacctctggacaagctgaacttcgaggccatcaac
ttctgtcggggtctgggcagccaggcatccaccgtgactgagattgtgaagcagcaagac
cccctggtctacaaggccatccagcaaggcatcaatgctgtgaaccaggaagccatgaac
aatgcacagaggattgaaaagtgggtcatcttggagaaggacttttccatctatggtgga
gagctaggtccaatgatgaaacttaagagacattttgtagcccagaaatacaaaaaacaa
attgatcacatgtaccactga

DBGET integrated database retrieval system