KEGG   Homo sapiens (human): 81617Help
Entry
81617             CDS       T01001                                 

Gene name
CAB39L, MO25-BETA, MO2L, bA103J18.3
Definition
calcium binding protein 39-like
Orthology
K08272  
calcium binding protein 39
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    81617 (CAB39L)
   04150 mTOR signaling pathway
    81617 (CAB39L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.2
AA seq 337 aa AA seqDB search
MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKE
PPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYIS
AHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIA
SDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRH
NFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPK
LIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgcctttgtttagtaaatcacacaaaaatccagcagaaattgtgaaaatc
ctgaaagacaatttggccattttggaaaagcaagacaaaaagacagacaaggcttcagaa
gaagtgtctaaatcactgcaagcaatgaaagaaattctgtgtggtacaaacgagaaagaa
cccccaacagaagcagtggctcagctagcacaagaactctacagcagtggcctgctagtg
acactgatagctgacctgcagctgatagactttgagggaaaaaaagatgtgacccagata
tttaacaacatcttgagaagacagataggcactcggagtcctactgtggagtatattagt
gctcatcctcatatcctgtttatgctcctcaaaggatatgaagccccacagattgcctta
cgttgtgggattatgctgagagaatgtattcgacatgaaccacttgccaaaatcatcctc
ttttctaatcaattcagagatttctttaagtacgtggagttgtcaacatttgatattgct
tcagatgcctttgctactttcaaggatttactaaccagacataaagtgttggtagcagac
ttcttagaacaaaattacgacactatttttgaagactatgagaaattgcttcagtctgag
aattatgttactaagagacagtctttaaagctgctaggggagctgatcctggaccgtcac
aactttgccatcatgacaaagtatatcagcaagccggagaacctgaaactcatgatgaac
ctccttcgggataaaagtcccaacatccagtttgaagcctttcatgtttttaaggtgttt
gtggccagtcctcacaaaacacagcctattgtggagatcctgttaaaaaatcagcccaaa
ctcattgagtttctgagcagcttccaaaaagaaaggacggatgatgagcagttcgctgac
gagaagaactacttgattaaacagatccgagacttgaagaaaacggccccttga

DBGET integrated database retrieval system