KEGG   Homo sapiens (human): 81624Help
Entry
81624             CDS       T01001                                 

Gene name
DIAPH3, AN, AUNA1, DIA2, DRF3, NSDAN, diap3, mDia2
Definition
diaphanous-related formin 3
Orthology
K05745  
diaphanous 3
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q21.2
AA seq 1193 aa AA seqDB search
MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKF
HLNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSEN
ELLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFI
HELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVK
KNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGE
ESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLH
IRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDV
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFT
YRKRLDLDLTQFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINEL
QAELQAFKSQFGALPADCNIPLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP
GMRMPFSGPVPPPPPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMT
ENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELKFLDSKIA
QNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNL
CEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNF
VDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISA
KEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKRE
AEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRK
RTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNL
DTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARLRAL
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atggaacggcaccagccgcggctgcaccacccggcccaaggctcagccgctgggactccc
tacccttcctcagcctctctccgcggctgccgggaaagcaagatgccgcgcaggaagggc
ccccaacaccctccgccgcccagtggccccgaggagcctggggagaagcgccccaagttt
catttaaatattaggacactgacggatgatatgctggacaaatttgccagcataagaatt
ccagggagcaagaaagagagacctccacttcccaacctgaagactgcatttgcaagcagt
gattgctcagcagcacctttagagatgatggagaactttccaaagccactgtcagagaat
gaactcttagaactttttgaaaaaatgatggaagatatgaatttaaatgaagataaaaag
gcaccattgcgggaaaaggacttcagtatcaaaaaagaaatggtgatgcagtacattaat
actgcttctaagacaggaagtcttaagagaagccgacagatctcacctcaggaattcatt
catgagctgaaaatggggtctgcagatgagagacttgtcacatgcctggagtctctccga
gtgtctttgaccagcaatcctgtgagttgggtggaaagctttggacatgaagggcttgga
ttattattagacattttggaaaaactgattagtggaaaaatccaagaaaaagttgtaaag
aaaaatcaacataaagtcatacagtgtctaaaagccctgatgaatacgcagtatggcttg
gaaagaattatgagtgaggagaggagcctttccttattggccaaagccgtggatcccaga
caccccaatatgatgacagatgtggttaaacttctctctgcggtatgcattgtaggggaa
gaaagcatccttgaagaagttttagaagctttaacttcagctggtgaagaaaaaaaaatt
gacagatttttttgtattgtggaaggcctccggcacaattcagttcaactgcaagtagct
tgtatgcagctcatcaatgccctggttacatctcctgatgatttggatttcaggcttcac
atcagaaatgaatttatgcgttgtggattgaaagagatattgccaaatttaaaatgcatt
aagaatgatggcctggatatccaacttaaagtctttgatgagcataaagaagaagatttg
tttgagttatcccatcgccttgaagatattagagctgaacttgatgaagcatatgatgtt
tacaacatggtgtggagcacagttaaagaaactagagcagagggatattttatttctatt
cttcagcatcttttgctgattcgaaatgattattttataaggcaacaatacttcaaatta
attgatgagtgtgtatcccagattgtattgcatagagatggaatggatccagacttcaca
tatcgaaaaagactagatttagatttaacccagtttgtagacatttgcatagatcaagca
aaactagaagagtttgaagagaaagcatcagaactttacaagaaatttgaaaaagagttt
accgaccaccaagaaactcaggctgaattgcagaaaaaagaggcaaagattaatgagctt
caagcagagctacaagcttttaagtctcagtttggtgccttgccagctgattgtaatatt
cctttgcctccctctaaagaaggtggaactggccactcagcacttcctcctccgcctcca
ctgccttctggtggaggggtgccgcctccacctcctcccccaccacctcctccacttcca
ggaatgcggatgccattcagtggtcctgtgcctccaccacctcccctgggattccttgga
ggacaaaattctcctcctctaccaatcctgccatttgggttgaaaccaaagaaagaattt
aaacctgaaatcagcatgagaagattgaattggttaaagatcagacctcatgaaatgact
gaaaactgtttctggataaaagtaaatgaaaataagtatgaaaacgtggatttgctttgt
aaacttgagaatacattttgttgccaacaaaaagagagaagagaagaggaagatattgaa
gagaagaaatcgattaagaaaaaaattaaagaacttaagtttttagattctaaaattgcc
cagaacctttcaatcttcctgagctcttttcgggtgccatatgaggaaatcagaatgatg
atattggaagtagatgaaacacggttggcagagtctatgattcagaacttaataaagcat
cttcctgatcaagagcaattaaattcattgtctcagttcaagagtgaatatagcaactta
tgtgaacctgagcagtttgtggttgtgatgagcaatgtgaagagactacggccacggctc
agtgctattctctttaagcttcagtttgaagagcaggtgaacaacatcaaacctgacatc
atggctgtcagtactgcctgcgaagagataaagaagagcaaaagctttagcaagttgctg
gaacttgtattgctaatgggaaactacatgaatgctggctcccggaatgctcaaaccttc
ggatttaaccttagctctctctgtaaactaaaggacacaaaatcagcagatcagaaaaca
acgctacttcatttcctggtagaaatatgtgaagagaagtaccctgatatactgaatttt
gtggatgatttggaacctttagacaaagctagtaaagtctctgtagaaacgctggaaaag
aatttgaggcagatgggaaggcagcttcaacagcttgagaaggaattggaaacctttccc
cctcctgaggacttgcatgacaagtttgtgacaaagatgtccagatttgttatcagtgca
aaagaacaatatgagacactttcgaagttacacgaaaacatggaaaagttataccagagt
ataataggatactatgccattgatgtgaagaaggtgtctgtggaagactttcttactgac
ctgaataacttcagaaccacattcatgcaagcaataaaggagaatatcaaaaaaagagaa
gcagaggaaaaagaaaaacgtgtcagaatagctaaagaattagcagagcgagaaagactc
gaacgccaacaaaagaaaaagcgtttattagaaatgaagactgagggtgatgagacagga
gtgatggataatctgctggaggccttgcagtccggggctgccttccgcgacagaagaaaa
aggacaccgatgccaaaagatgttcggcagagtctcagtccaatgtctcagaggcctgtt
ctgaaagtttgtaaccatgaaaatcagaaagtgcagttgacagaagggtcacgttcacac
tacaatatcaattgcaactcaacaaggactccagtcgccaaggagcttaattataatcta
gacactcatacgtctactgggaggatcaaggcagctgagaagaaggaagcgtgtaatgta
gaaagcaacagaaaaaaggaaacggaacttcttggctctttttctaaaaatgaatcagtt
cccgaagttgaagccctgctggcaagattacgagctttataa

DBGET integrated database retrieval system