KEGG   Homo sapiens (human): 81693Help
Entry
81693             CDS       T01001                                 

Gene name
AMN, PRO1028, amnionless
Definition
amnion associated transmembrane protein
Organism
hsa  Homo sapiens (human)
Disease
H01277  
Vitamin B12 deficiency anaemia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.3
AA seq 453 aa AA seqDB search
MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLV
QEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRS
GDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLA
VFLASRAGRLRFHGPGALSVGPEDCADPSGCVCGNAEAQPWICAALLQPLGGRCPQAACH
SALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYHGLQVAVSKVPRSSRL
READTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESGAHVWGSSAAG
LAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP
LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcctgggccgggtcctgctgtggctgcagctctgcgcactgacccaggcggtc
tccaaactctgggtccccaacacggacttcgacgtcgcagccaactggagccagaaccgg
accccgtgcgccggcggcgccgttgagttcccggcggacaagatggtgtcagtcctggtg
caagaaggtcacgccgtctcagacatgctcctgccgctggatggggaactcgtcctggct
tcaggagccggattcggcgtctcagacgtgggctcgcacctggactgtggcgcgggcgaa
cctgccgtcttccgcgactctgaccgcttctcctggcatgacccgcacctgtggcgctct
ggggacgaggcacctggcctcttcttcgtggacgccgagcgcgtgccctgccgccacgac
gacgtcttctttccgcctagtgcctccttccgcgtggggctcggccctggcgctagcccc
gtgcgtgtccgcagcatctcggctctgggccggacgttcacgcgcgacgaggacctggct
gttttcctggcgtcccgcgcgggccgcctacgcttccacgggccgggcgcgctgagcgtg
ggccccgaggactgcgcggacccgtcgggctgcgtctgcggcaacgcggaggcgcagccg
tggatctgcgcggccctgctccagcccctgggcggccgctgcccccaggccgcctgccac
agcgccctccggccccaggggcagtgctgtgacctctgtggagccgttgtgttgctgacc
cacggccccgcatttgacctggagcggtaccgggcgcggatactggacaccttcctgggt
ctgcctcagtaccacgggctgcaggtggccgtgtccaaggtgccacgctcgtcccggctc
cgtgaggccgatacggagatccaggtggtgctggtggagaatgggcccgagacaggcgga
gcggggcggctggcccgggccctcctggcggacgtcgccgagaacggcgaggccctcggc
gtcctggaggcgaccatgcgggagtcgggcgcacacgtctggggcagctccgcggctggg
ctggcgggcggcgtggcggctgccgtgctgctggcgctgctggtcctgctggtggcgccg
ccgctgctgcgccgcgcggggaggctcaggtggaggaggcacgaggcggcggccccggct
ggagcgcccctcggcttccgcaacccggtgttcgacgtgacggcctccgaggagctgccc
ctgccgcggcggctcagcctggttccgaaggcggccgcagacagcaccagccacagttac
ttcgtcaaccctctgttcgccggggccgaggccgaggcctga

DBGET integrated database retrieval system