KEGG   Homo sapiens (human): 81696Help
Entry
81696             CDS       T01001                                 

Gene name
OR5V1, 6M1-21, hs6M1-21
Definition
(RefSeq) olfactory receptor family 5 subfamily V member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    81696 (OR5V1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    81696 (OR5V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 81696
NCBI-ProteinID: NP_110503
HGNC: 13972
Ensembl: ENSG00000243729
Vega: OTTHUMG00000031199
Pharos: Q9UGF6(Tdark)
UniProt: Q9UGF6 A0A126GV99
Position
6p22.1
AA seq 321 aa AA seqDB search
MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMY
YFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAY
DRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCD
IPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFST
CASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEA
VKTIGSKWQPPISSLDSKLTY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaagaatcaaacagctataactgaattcatcatcttgggattctccaaccta
aatgaattgcagtttttactattcaccatcttctttctgacttatttctgtactttggga
ggaaatatattaattatcttgacgactgtgactgatccacacctgcatacacctatgtat
tattttctagggaacttggcctttattgacatctgctacaccaccagcaatgtcccccag
atgatggtgcacctcctctcaaagaaaaaaagcatttcttatgtggggtgtgtggttcaa
ctttttgcatttgttttctttgtaggatcagagtgtctcctactggcagcaatggcatat
gatcgttacattgcaatctgcaatcctttaaggtattcagttattctgagcaaggttcta
tgcaatcaattagcagcctcatgctgggctgctggtttccttaactcagtggtgcataca
gtgttgacattctgcctgcccttctgtggcaacaatcagattaattacttcttctgtgac
atcccccctttgctgatcttgtcttgtggaaacacttctgtcaatgagttggcactgcta
tccactggggtcttcattggttggactcctttcctttgtatcgtactttcctacatttgc
ataatctccaccatcttgaggatccagtcctcagagggaagacgaaaagccttctctaca
tgtgcctcccacctggccattgtctttctcttttatggcagcgccatctttacatatgta
cggcccatctcaacttactcattaaagaaagataggttggtttcagtgttgtacagtgtt
gttacccccatgctaaaccctataatttacacattgaggaataaggacatcaaagaagct
gtcaaaactatagggagcaagtggcagccaccaatttcctctttggatagtaaactcact
tattga

DBGET integrated database retrieval system