KEGG   Homo sapiens (human): 81696Help
Entry
81696             CDS       T01001                                 

Gene name
OR5V1, 6M1-21, hs6M1-21
Definition
olfactory receptor, family 5, subfamily V, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
6p22.1
AA seq 321 aa AA seqDB search
MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMY
YFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAY
DRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCD
IPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFST
CASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEA
VKTIGSKWQPPISSLDSKLTY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaagaatcaaacagctataactgaattcatcatcttgggattctccaaccta
aatgaattgcagtttttactattcaccatcttctttctgacttatttctgtactttggga
ggaaatatattaattatcttgacgactgtgactgatccacacctgcatacacctatgtat
tattttctagggaacttggcctttattgacatctgctacaccaccagcaatgtcccccag
atgatggtgcacctcctctcaaagaaaaaaagcatttcttatgtggggtgtgtggttcaa
ctttttgcatttgttttctttgtaggatcagagtgtctcctactggcagcaatggcatat
gatcgttacattgcaatctgcaatcctttaaggtattcagttattctgagcaaggttcta
tgcaatcaattagcagcctcatgctgggctgctggtttccttaactcagtggtgcataca
gtgttgacattctgcctgcccttctgtggcaacaatcagattaattacttcttctgtgac
atcccccctttgctgatcttgtcttgtggaaacacttctgtcaatgagttggcactgcta
tccactggggtcttcattggttggactcctttcctttgtatcgtactttcctacatttgc
ataatctccaccatcttgaggatccagtcctcagagggaagacgaaaagccttctctaca
tgtgcctcccacctggccattgtctttctcttttatggcagcgccatctttacatatgta
cggcccatctcaacttactcattaaagaaagataggttggtttcagtgttgtacagtgtt
gttacccccatgctaaaccctataatttacacattgaggaataaggacatcaaagaagct
gtcaaaactatagggagcaagtggcagccaccaatttcctctttggatagtaaactcact
tattga

DBGET integrated database retrieval system