KEGG   Homo sapiens (human): 81704Help
Entry
81704             CDS       T01001                                 

Gene name
DOCK8, MRD2, ZIR8
Definition
dedicator of cytokinesis 8
Organism
hsa  Homo sapiens (human)
Disease
H00773  
Non-syndromic autosomal dominant mental retardation
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p24.3
AA seq 1999 aa AA seqDB search
MTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE
WLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPRHLNVLCDV
SGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFALYPSVDEE
DAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKISENFHCDLN
SDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGDCAEPYTVI
KESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLEREVTDVDSVV
GRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLSDEDLFKFL
ADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRPHKEILEFP
TREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGP
EFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGY
SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQA
VSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMALEHELKLSIICLNSSRLEPL
VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLL
ASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARVMSSSNPDL
AGTHSAADEEVKNIMSSKHFHEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHN
MDKRDSFRRTRFSDRFMDDITTIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLL
SLMDRGFVFNLIRHYCSQLSAKLSNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAP
TSPCPSISSQNSSSCSSFQDQKIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISK
VQRKAVSAIHSLLSSHDLDPRCVKPEVKVKIAALYLPLVGIILDALPQLCDFTVADTRRY
RTSGSDEEQEGAGAINQNVALAIAGNNFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICF
LWIMKNADQSLIRKWIADLPSTQLNRILDLLFICVLCFEYKGKQSSDKVSTQVLQKSRDV
KARLEEALLRGEGARGEMMRRRAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELD
QEALISGNLATEAHLIILDMQENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSTTYLTH
CFATLRALIAKFGDLLFEEEVEQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGA
TSNFARVKMQVTMSLASLVGRAPDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELL
CNLNSILYDTVKMREFQEDPEMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTE
AAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESVVSEDTLSPDEDGVCAG
QYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFD
SIVNKDHKRMFGTYFRVGFFGSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAE
FVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFT
LEGRPRGELHEQYRRNTVLTTMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLA
VAINQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEF
IMRCGEAVEKNKRLITADQREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKR
DSFHRSSFRKCETQLSQGS
NT seq 6000 nt NT seq  +upstreamnt  +downstreamnt
atgacacacctgaacagcctggatgtgcagcttgcccaggagctcggggacttcactgat
gacgacttggacgtggtgttcacgccaaaggaatgtaggactttgcagccctctttgccg
gaggaaggggttgaactggaccctcatgtcagggactgtgttcagacctacatccgtgag
tggctaatcgtgaaccggaaaaaccaaggaagtccagaaatctgtggctttaaaaagact
ggatctcgaaaagattttcacaagacgcttccgaaacagacgtttgagtcggaaaccttg
gagtgcagtgaacccgctgctcaggcaggcccccgccacttaaacgtgctgtgcgacgtg
tctgggaaaggccccgtcactgcctgtgactttgacctccgcagcctgcagcctgacaag
cggctagaaaacctcctgcagcaagtgagtgccgaggactttgagaagcagaacgaggag
gcccggaggaccaataggcaggccgagctctttgccctttacccatcagtggacgaggag
gatgctgtggaaatacgtccagtaccagaatgtcccaaggaacacctgggcaacagaata
ttggtcaagttgctgaccttgaagttcgagattgaaattgagcccctgtttgccagcatt
gccctctacgatgttaaagaaaggaaaaagatctcagaaaattttcactgtgacctgaac
tctgaccagttcaaaggatttctgcgagctcacacgccttcagtggccgcatcaagtcag
gcgagatctgcagtcttctcagtcacctacccgtcctcagacatctacctggtagtcaag
attgaaaaagtcctgcagcagggagagattggagactgtgcagagccctacacggttatc
aaagaaagtgatggtggaaagagtaaagaaaagattgaaaaactaaaactccaagctgaa
tccttctgccagcgtttggggaaataccggatgccctttgcctgggcacccataagctta
tcaagcttcttcaatgtctccacccttgagagggaggtaactgatgtggactctgtggtt
gggagaagctcagtgggtgaacggaggacattggcccaatctagaaggctttctgaaaga
gccctctccttggaggaaaatggggttggatccaacttcaaaacctccactctgagcgtt
agcagctttttcaagcaggaaggagatcgccttagcgatgaagacttattcaagttttta
gctgactacaaaagatcatcatccttacagagacgagtcaagtcaattccaggcttgcta
agactggagatttctacagctccagagatcatcaattgctgtctgactcctgaaatgctg
cccgtgaaaccctttcctgaaaaccggacacgcccgcacaaagagattttggaatttcca
acacgagaagtatatgtccctcacactgtgtacagaaaccttctctatgtctacccacag
aggctgaactttgtaaacaaactagcatcagcccggaacattacaataaagatccagttt
atgtgtggagaagatgctagcaatgcgatgccggtcatctttggaaaatccagcgggcct
gaatttctgcaggaagtgtacacagctgttacataccataataagtctcctgacttttat
gaagaagtgaaaattaagctccccgctaagctcacagtaaatcaccacctcctgttcacc
ttctaccatatcagctgtcagcagaagcaaggagcctccgtggaaactctcctgggatat
tcatggctgccaattctcttaaatgaacgtcttcaaactggatcctactgtctcccagtt
gccttggaaaaattgccacccaactactccatgcattctgctgagaaagtcccattacag
aatcctcccattaagtgggctgaaggacataagggagtatttaatattgaagtgcaagct
gtttcttctgtacacacccaggacaaccacctggagaagttcttcaccctctgccactcc
ctggagagccaggtgaccttccccatccgcgtgctggatcagaaaatcagcgagatggcg
ctggagcatgagctgaagctcagcatcatctgcctgaactcctcccgcctggagccgctc
gtgctcttcctgcacctggtgctggacaagctcttccagctgtccgtgcagcccatggtc
atcgctggccagacagccaacttctcccagtttgccttcgagtccgtggtggccatcgcc
aacagtctgcacaacagcaaggacctgagcaaggaccagcatgggaggaactgcctgctg
gcttcctacgtgcactacgtcttccgcctgccagaggtgcaaagggatgtgcccaagtca
ggcgctcccactgccctcctagaccctcggagctaccacacgtatggccgcacatcagct
gctgctgtgagttcaaagctgctgcaggcccgggtgatgagcagcagtaacccagacctc
gcggggacacactccgcagcagacgaggaagtgaagaacatcatgtcttcaaagcatttc
catgaggagcttgcccttcagatggtggtcagcaccggaatggtgagagaaacagtcttc
aagtatgcctggttcttctttgagcttctggtgaaaagcatggcccagcacgtacataac
atggacaaacgggacagttttcggaggactcgtttttctgaccgtttcatggatgacata
actactattgttaatgtggtcacctcggaaattgcagcccttttagtaaaaccacagaag
gaaaatgaacaggcggaaaagatgaacatcagcctggctttcttcttgtatgaccttctc
tccctcatggatcggggctttgtgtttaacctcatcagacattattgcagccagctgtca
gccaagctcagtaaccttccaacgctcatttccatgaggctagagttcctgagaatcctc
tgtagccatgagcattacctcaatctgaaccttttttttatgaatgctgatactgctcca
acatctccttgtccttccatatcttcccagaactcaagctcctgctccagcttccaggac
cagaagatcgccagcatgttcgatctgacttccgagtaccgccagcagcacttcctcacc
gggctcctcttcacagaactggctgctgccctggatgccgaaggggaaggaatcagcaaa
gtacaaaggaaagctgtcagtgcaattcacagcctgctaagttctcacgacctggaccca
cgctgtgtcaaaccagaggtgaaggtcaaaatcgccgccctttacctacctttagttggc
atcattttggatgctttgccacagctctgtgactttacagttgcagatactcgcagatac
cgcaccagtggctcggatgaagaacaagaaggagccggtgccattaaccagaatgtggct
ctggccatagcagggaataatttcaatttgaaaacaagtggaatagtgctgtcttccttg
ccctataagcagtacaacatgctgaacgcggacactactcgcaacctcatgatctgcttc
ctctggatcatgaaaaatgctgatcagagcctcattaggaagtggattgctgacctgcca
tcaacgcagctcaacaggattttagatctacttttcatctgtgtgttatgttttgagtat
aagggaaaacagagttctgacaaagtcagtacccaagtcctgcagaagtcaagggatgtc
aaggcccggctggaagaggctttgctccgtggggaaggggccagaggggagatgatgcgc
cgccgggctccagggaacgaccgatttccaggcctaaatgaaaatttgagatggaagaaa
gagcagacacattggcggcaagctaatgagaagctagataaaacaaaggccgagttagat
caagaagccttgatcagtggcaatctggctacagaagcacatttaatcatcctggatatg
caggaaaacattatccaggcgagctcggctctggactgtaaagacagcctgctgggaggt
gttctgagggtgctggtgaattctctgaactgtgatcagagtaccacctacctgactcac
tgctttgcaacactccgtgctctcatcgccaagtttggagacttactcttcgaagaggag
gtggaacagtgtttcgacctatgtcaccaagtcctgcaccactgcagcagcagcatggat
gtcacccggagccaagcctgtgccaccctttacctcctcatgaggttcagttttggagcc
accagtaattttgcaagagtaaagatgcaagtaaccatgtccctggcatctttggtggga
agagcaccagactttaatgaagagcacctgagaagatccttgaggacaattttggcctat
tcagaagaggacacagccatgcagatgactccttttcccacccaggtggaggaacttctc
tgtaatctgaatagcatcttatatgacacagtgaaaatgagggaatttcaggaagatcct
gagatgcttatggatctcatgtacagaattgccaagagttaccaggcatctcctgatctg
cggctgacctggctccagaacatggcagagaaacacaccaagaagaagtgctacacggag
gctgccatgtgcctggtgcacgccgctgcgttagtggctgagtatctgagcatgctggag
gaccacagctacctgcccgtgggcagtgtcagcttccagaatatttcttccaatgtgctg
gaggagtctgtggtctctgaggacaccctgtcacctgacgaggatggggtgtgcgcaggc
cagtacttcaccgagagtggcctggtaggcctcctggagcaggccgcggagctcttcagc
acgggaggcttatatgagacagttaatgaggtctacaagctggtcatccccatcctagaa
gcgcatcgagaattccggaagctgacactcactcacagcaagctgcagagagccttcgac
agcatcgttaacaaggatcataagagaatgtttggaacctacttccgagttggtttcttt
ggatccaaatttggggatttggatgaacaggagtttgtctacaaagagcctgcaattacc
aagcttcctgagatctcacatagactagaggcattttatggtcaatgttttggtgcagaa
tttgtggaagtgattaaagactccactcctgtggacaaaaccaagttggatcctaacaag
gcctacatacagatcacttttgtggagccctactttgatgagtatgagatgaaagacagg
gtcacatactttgagaagaatttcaacctccggaggttcatgtacaccaccccgttcacc
ctggaggggcggcctcggggagagctgcatgagcagtacagaaggaacacagtcctgacc
actatgcacgccttcccctacatcaagaccaggatcagcgtcatccagaaggaggagttt
gttttgacaccgattgaagttgccattgaagacatgaagaagaagaccctgcagttagca
gttgccattaaccaggagccgcctgatgcaaagatgcttcagatggtgctgcaaggctct
gtgggagctactgtaaatcagggaccactggaagtagcccaagtgtttttggctgaaatt
cctgctgatccaaaactctatcgacatcacaacaagttgaggttatgctttaaggaattc
atcatgagatgtggtgaagctgtagagaaaaacaagcgtctcatcacggcagaccagagg
gaatatcagcaggaactcaaaaagaactataacaagctaaaagagaacctcaggccaatg
atcgagcggaaaattccagaactgtacaagccaatattcagagttgagagtcaaaagagg
gactccttccacagatctagtttcaggaaatgtgaaacccagttgtcacagggcagctaa

DBGET integrated database retrieval system