KEGG   Homo sapiens (human): 8178Help
Entry
8178              CDS       T01001                                 

Gene name
ELL, C19orf17, ELL1, MEN, PPP1R68
Definition
(RefSeq) elongation factor for RNA polymerase II
  KO
K15183  
RNA polymerase II elongation factor ELL
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8178 (ELL)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     8178 (ELL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P55199(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.11
AA seq 621 aa AA seqDB search
MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
GHISIPQPDCPAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITV
CATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRAT
PINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKD
ALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGS
LLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPN
GREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHAT
PGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLH
ARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHS
KLAHIKRLIAEYDQRQLQAWP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgaaggaggataggagctacgggctgtcgtgcgggcgggttagcgacggc
agcaaggtgtcggtgttccacgtgaagctcaccgacagtgccctgagggccttcgagagc
taccgcgccagacaggattctgtttcactgaggccatctatccgatttcaaggaagccaa
gggcacatctccatcccccagcctgactgccccgcagaggcgcggacgttctccttctac
ctctccaacatcggccgcgacaacccccagggcagcttcgactgcatccagcagtatgtc
tccagtcatggggaagttcacctggactgcctgggcagcatacaggacaagatcacggtg
tgtgccaccgacgactcctaccagaaggcgcggcagagcatggcccaggcggaggaggag
acgcggagccgaagtgccattgtcatcaaggctggaggccgctacctgggcaagaaggtt
cagtttcggaaaccagccccaggtgcaacagacgcggtgccctcccggaagcgggcaacc
cccatcaacttggcgagtgccatcaggaagagtggtgccagtgccgtgagtgggggcagc
ggggtgtcccagaggcccttccgtgaccgagtgctgcacctcctggcactacggccctac
cgcaaggctgagctgctgctgcgactgcagaaggacggcctgacgcaggcggacaaggac
gcgctggatggcctcctccagcaggtggccaacatgagtgctaaggacggcacgtgtaca
ctgcaggactgcatgtacaaggatgtgcagaaggactggcctggctactcggagggggac
cagcagctgctgaagcgggtgctcgtccggaagctgtgccagccacagagcactggcagc
ctccttggagaccctgctgcctccagccccccaggcgagcgtgggcgctcggcctcgccc
ccacagaagcggctgcagcctcctgatttcatcgaccccctagccaacaagaaaccccgg
atatcgcacttcactcagagagctcagcctgccgtcaacgggaagctgggcgtgcccaat
ggccgtgaggccttgctgcccaccccgggcccaccagccagcacggacaccctcagctcc
agcactcacctgcccccgcggctggagcccccgagggcccacgaccccctggccgatgtc
agcaatgacctgggccacagcggccgagactgtgagcacggagaggcggctgccccagcc
cccactgtgcgcctcggcctgcccctgctgacggactgtgcccagcccagcaggccacac
ggcagcccctcgcgcagcaagcccaagaagaagtccaagaagcacaaagacaaggagagg
gcggctgaggacaagccccgggcccagcttccagactgtgcacctgccacccatgccacc
cccggagccccagcagacaccccaggtttaaacggaacctgcagcgtttccagtgttccc
acgtccacgtcggagacgcctgactacttgctgaagtacgcagccatctcctcttcggag
cagcgccagagctacaagaacgacttcaatgccgagtacagcgagtaccgcgacctgcac
gcccgcattgagcgcatcacgcggcggttcacccagctcgacgcccagctccggcagctc
tcccagggctccgaggagtatgagactactcgagggcagattttgcaggaatatcgaaaa
atcaaaaagaccaacaccaactacagccaggagaagcaccgctgcgagtacctgcacagc
aagctggcccacatcaagaggctcatcgccgagtacgaccagcggcagctgcaggcttgg
ccctag

DBGET integrated database retrieval system