KEGG   Homo sapiens (human): 81794Help
Entry
81794             CDS       T01001                                 

Gene name
ADAMTS10, ADAM-TS10, ADAMTS-10, WMS, WMS1
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 10
  KO
K08625  a disintegrin and metalloproteinase with thrombospondin motifs 10 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00673  Weill-Marchesani syndrome
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     81794 (ADAMTS10)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   81794 (ADAMTS10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep_M12B_propep ADAM_spacer1 Reprolysin TSP_1 Reprolysin_5 Reprolysin_3 Reprolysin_2 PLAC Reprolysin_4 DUF4953 Peptidase_M57 DAGK_cat AAT
Motif
Other DBs
NCBI-GeneID: 81794
NCBI-ProteinID: NP_112219
OMIM: 608990
HGNC: 13201
Ensembl: ENSG00000142303
Vega: OTTHUMG00000182216
Pharos: Q9H324(Tbio)
UniProt: Q9H324 A0A0A0MQW6 Q6ZN14 Q59FE5
Position
19p13.2
AA seq 1103 aa AA seqDB search
MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPP
PRRQRRGTGATAESRLFYKVASPSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARP
HCLYAGHLQGQASSSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGSRSPEESGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNILVTRLILLTEDQPT
LEITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGT
LGLAPVGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDD
CPPGSQDFREVQCSEFDSIPFRGKFYKWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPGAG
YEDVVWIPKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLPLAGTTFQLRQ
GPDQVQSLEALGPINASLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQ
CAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSLCSRSC
DAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSC
GPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCG
VGQRQRSVRCTSHTGQASHECTEALRPPTTQQCEAKCDSPTPGDGPEECKDVNKVAYCPL
VLKFQFCSRAYFRQMCCKTCHGH
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgcctgccagatcctccgctgggccctcgccctggggctgggcctcatgttc
gaggtcacgcacgccttccggtctcaagatgagttcctgtccagtctggagagctatgag
atcgccttccccacccgcgtggaccacaacggggcactgctggccttctcgccacctcct
ccccggaggcagcgccgcggcacgggggccacagccgagtcccgcctcttctacaaagtg
gcctcgcccagcacccacttcctgctgaacctgacccgcagctcccgtctactggcaggg
cacgtctccgtggagtactggacacgggagggcctggcctggcagagggcggcccggccc
cactgcctctacgctggtcacctgcagggccaggccagcagctcccatgtggccatcagc
acctgtggaggcctgcacggcctgatcgtggcagacgaggaagagtacctgattgagccc
ctgcacggtgggcccaagggttctcggagcccggaggaaagtggaccacatgtggtgtac
aagcgttcctctctgcgtcacccccacctggacacagcctgtggagtgagagatgagaaa
ccgtggaaagggcggccatggtggctgcggaccttgaagccaccgcctgccaggcccctg
gggaatgaaacagagcgtggccagccaggcctgaagcgatcggtcagccgagagcgctac
gtggagaccctggtggtggctgacaagatgatggtggcctatcacgggcgccgggatgtg
gagcagtatgtcctggccatcatgaacattgttgccaaacttttccaggactcgagtctg
ggaagcaccgttaacatcctcgtaactcgcctcatcctgctcacggaggaccagcccact
ctggagatcacccaccatgccgggaagtccctggacagcttctgtaagtggcagaaatcc
atcgtgaaccacagcggccatggcaatgccattccagagaacggtgtggctaaccatgac
acagcagtgctcatcacacgctatgacatctgcatctacaagaacaaaccctgcggcaca
ctaggcctggccccggtgggcggaatgtgtgagcgcgagagaagctgcagcgtcaatgag
gacattggcctggccacagcgttcaccattgcccacgagatcgggcacacattcggcatg
aaccatgacggcgtgggaaacagctgtggggcccgtggtcaggacccagccaagctcatg
gctgcccacattaccatgaagaccaacccattcgtgtggtcatcctgcagccgtgactac
atcaccagctttctagactcgggcctggggctctgcctgaacaaccggccccccagacag
gactttgtgtacccgacagtggcaccgggccaagcctacgatgcagatgagcaatgccgc
tttcagcatggagtcaaatcgcgtcagtgtaaatacggggaggtctgcagcgagctgtgg
tgtctgagcaagagcaaccggtgcatcaccaacagcatcccggccgccgagggcacgctg
tgccagacgcacaccatcgacaaggggtggtgctacaaacgggtctgtgtcccctttggg
tcgcgcccagagggtgtggacggagcctgggggccgtggactccatggggcgactgcagc
cggacctgtggcggcggcgtgtcctcttctagccgtcactgcgacagccccaggccaacc
atcgggggcaagtactgtctgggtgagagaaggcggcaccgctcctgcaacacggatgac
tgtccccctggctcccaggacttcagagaagtgcagtgttctgaatttgacagcatccct
ttccgtgggaaattctacaagtggaaaacgtaccggggagggggcgtgaaggcctgctcg
ctcacgtgcctagcggaaggcttcaacttctacacggagagggcggcagccgtggtggac
gggacaccctgccgtccagacacggtggacatttgcgtcagtggcgaatgcaagcacgtg
ggctgcgaccgagtcctgggctccgacctgcgggaggacaagtgccgagtgtgtggcggt
gacggcagtgcctgcgagaccatcgagggcgtcttcagcccagcctcacctggggccggg
tacgaggatgtcgtctggattcccaaaggctccgtccacatcttcatccaggatctgaac
ctctctctcagtcacttggccctgaagggagaccaggagtccctgctgctggaggggctg
cctgggaccccccagccccaccgtctgcctctagctgggaccacctttcaactgcgacag
gggccagaccaggtccagagcctcgaagccctgggaccgattaatgcatctctcatcgtc
atggtgctggcccggaccgagctgcctgccctccgctaccgcttcaatgcccccatcgcc
cgtgactcgctgcccccctactcctggcactatgcgccctggaccaagtgctcggcccag
tgtgcaggcggtagccaggtgcaggcggtggagtgccgcaaccagctggacagctccgcg
gtcgccccccactactgcagtgcccacagcaagctgcccaaaaggcagcgcgcctgcaac
acggagccttgccctccagactgggttgtagggaactggtcgctctgcagccgcagctgc
gatgcaggcgtgcgcagccgctcggtcgtgtgccagcgccgcgtctctgccgcggaggag
aaggcgctggacgacagcgcatgcccgcagccgcgcccacctgtactggaggcctgccac
ggccccacttgccctccggagtgggcggccctcgactggtctgagtgcacccccagctgc
gggccgggcctccgccaccgcgtggtcctttgcaagagcgcagaccaccgcgccacgctg
cccccggcgcactgctcacccgccgccaagccaccggccaccatgcgctgcaacttgcgc
cgctgccccccggcccgctgggtggctggcgagtggggtgagtgctctgcacagtgcggc
gtcgggcagcggcagcgctcggtgcgctgcaccagccacacgggccaggcgtcgcacgag
tgcacggaggccctgcggccgcccaccacgcagcagtgtgaggccaagtgcgacagccca
acccccggggacggccctgaagagtgcaaggatgtgaacaaggtcgcctactgccccctg
gtgctcaaatttcagttctgcagccgagcctacttccgccagatgtgctgcaaaacctgc
catggccactag

DBGET integrated database retrieval system