KEGG   Homo sapiens (human): 81794Help
Entry
81794             CDS       T01001                                 

Gene name
ADAMTS10, ADAM-TS10, ADAMTS-10, WMS, WMS1
Definition
ADAM metallopeptidase with thrombospondin type 1 motif, 10
Orthology
K08625  
a disintegrin and metalloproteinase with thrombospondin motifs 10 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00673  
Weill-Marchesani syndrome
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     81794 (ADAMTS10)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   81794 (ADAMTS10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 590 aa AA seqDB search
MGPTSVLRAGLTPSCLPPPSGATNGSVSPLGRAQRVWTEPGGRGLHGATAAGPVAAACPL
LAVTATAPGQPSGASTVWVREGGTAPATRMTVPLAPRTSEKCSVLNLTASLSVGNSTSGK
RTGEACSLTCLAEGFNFYTERAAAVVDGTPCRPDTVDICVSGECKHVGCDRVLGSDLRED
KCRVCGGDGSACETIEGVFSPASPGAGYEDVVWIPKGSVHIFIQDLNLSLSHLALKGDQE
SLLLEGLPGTPQPHRLPLAGTTFQLRQGPDQVQSLEALGPINASLIVMVLARTELPALRY
RFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLP
KRQRACNTEPCPPDWVVGNWSLCSRSCDAGVRSRSVVCQRRVSAAEEKALDDSACPQPRP
PVLEACHGPTCPPEWAALDWSECTPSCGPGLRHRVVLCKSADHRATLPPAHCSPAAKPPA
TMRCNLRRCPPARWVAGEWGECSAQCGVGQRQRSVRCTSHTGQASHECTEALRPPTTQQC
EAKCDSPTPGDGPEECKDVNKVAYCPLVLKFQFCSRAYFRQMCCKTCHGH
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggggccgacgagtgtcctccgggctggactcactccttcctgtctccccccacccagt
ggtgctacaaacgggtctgtgtcccctttgggtcgcgcccagagggtgtggacggagcct
gggggccgtggactccatggggcgactgcagccggacctgtggcggcggcgtgtcctctt
ctagccgtcactgcgacagccccaggccaaccatcgggggcaagtactgtctgggtgaga
gaaggcggcaccgctcctgcaacacggatgactgtccccctggctcccaggacttcagag
aagtgcagtgttctgaatttgacagcatccctttccgtgggaaattctacaagtggaaaa
cgtaccggggaggcctgctcgctcacgtgcctagcggaaggcttcaacttctacacggag
agggcggcagccgtggtggacgggacaccctgccgtccagacacggtggacatttgcgtc
agtggcgaatgcaagcacgtgggctgcgaccgagtcctgggctccgacctgcgggaggac
aagtgccgagtgtgtggcggtgacggcagtgcctgcgagaccatcgagggcgtcttcagc
ccagcctcacctggggccgggtacgaggatgtcgtctggattcccaaaggctccgtccac
atcttcatccaggatctgaacctctctctcagtcacttggccctgaagggagaccaggag
tccctgctgctggaggggctgcctgggaccccccagccccaccgtctgcctctagctggg
accacctttcaactgcgacaggggccagaccaggtccagagcctcgaagccctgggaccg
attaatgcatctctcatcgtcatggtgctggcccggaccgagctgcctgccctccgctac
cgcttcaatgcccccatcgcccgtgactcgctgcccccctactcctggcactatgcgccc
tggaccaagtgctcggcccagtgtgcaggcggtagccaggtgcaggcggtggagtgccgc
aaccagctggacagctccgcggtcgccccccactactgcagtgcccacagcaagctgccc
aaaaggcagcgcgcctgcaacacggagccttgccctccagactgggttgtagggaactgg
tcgctctgcagccgcagctgcgatgcaggcgtgcgcagccgctcggtcgtgtgccagcgc
cgcgtctctgccgcggaggagaaggcgctggacgacagcgcatgcccgcagccgcgccca
cctgtactggaggcctgccacggccccacttgccctccggagtgggcggccctcgactgg
tctgagtgcacccccagctgcgggccgggcctccgccaccgcgtggtcctttgcaagagc
gcagaccaccgcgccacgctgcccccggcgcactgctcacccgccgccaagccaccggcc
accatgcgctgcaacttgcgccgctgccccccggcccgctgggtggctggcgagtggggt
gagtgctctgcacagtgcggcgtcgggcagcggcagcgctcggtgcgctgcaccagccac
acgggccaggcgtcgcacgagtgcacggaggccctgcggccgcccaccacgcagcagtgt
gaggccaagtgcgacagcccaacccccggggacggccctgaagagtgcaaggatgtgaac
aaggtcgcctactgccccctggtgctcaaatttcagttctgcagccgagcctacttccgc
cagatgtgctgcaaaacctgccatggccactag

  All links  
No link information was found.   
DBGET integrated database retrieval system