KEGG   Homo sapiens (human): 81849Help
Entry
81849             CDS       T01001                                 

Gene name
ST6GALNAC5, SIAT7E, ST6GalNAcV
Definition
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
Orthology
K03375  
N-acetylgalactosaminide alpha-2,6-sialyltransferase (sialyltransferase 7E) [EC:2.4.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    81849 (ST6GALNAC5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.-  
     81849 (ST6GALNAC5)
Glycosyltransferases [BR:hsa01003]
 Terminal extension
  Sialyltransferase
   81849 (ST6GALNAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p31.1
AA seq 336 aa AA seqDB search
MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAA
ESSTQQRPGVPAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECV
IRMNDAPTRGYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRD
GKGQVYNNLHLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTI
ALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITE
KRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctgatgcgccatggtctggcagtgtgtttagcgctcaccaccatgtgcacc
agcttgttgctagtgtacagcagcctcggcggccagaaggagcggcccccgcagcagcag
cagcagcagcagcaacagcagcagcaggcgtcggccaccggcagctcgcagccggcggcg
gagagcagcacccagcagcgccccggggtccccgcgggaccgcggccactggacggatac
ctcggagtggcggaccacaagcccctgaaaatgcactgcagggactgtgccctggtgacc
agctcagggcatctgctgcacagtcggcaaggctcccagattgaccagacagagtgtgtc
atccgcatgaatgacgcccccacacgcggctatgggcgtgacgtgggcaatcgcaccagc
ctgagggtcatcgcgcattccagcatccagaggatcctccgcaaccgccatgacctgctc
aacgtgagccagggcaccgtgttcatcttctggggccccagcagctacatgcggcgggac
ggcaagggccaggtctacaacaacctgcatctcctgagccaggtgctgccccggctgaag
gccttcatgattactcgccacaagatgctgcagtttgatgagctcttcaagcaggagact
ggcaaagacaggaagatatccaacacttggctcagcactggctggtttacaatgacaatt
gcactggagctctgtgacaggatcaatgtttatggcatggtgcccccagacttctgcagg
gatcccaatcacccttcagtaccttatcattattatgaaccttttggacctgatgaatgt
acaatgtacctctcccatgagcgaggacgcaagggcagtcatcaccgctttatcacagag
aaacgagtctttaagaactgggcacggacattcaatattcacttttttcaaccagactgg
aaaccagaatcacttgctataaatcatcctgagaataaacctgtgttctaa

DBGET integrated database retrieval system