KEGG   Homo sapiens (human): 81873Help
Entry
81873             CDS       T01001                                 

Gene name
ARPC5L, ARC16-2
Definition
(RefSeq) actin related protein 2/3 complex subunit 5 like
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    81873 (ARPC5L)
  Cell motility
   04810 Regulation of actin cytoskeleton
    81873 (ARPC5L)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    81873 (ARPC5L)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    81873 (ARPC5L)
   05132 Salmonella infection
    81873 (ARPC5L)
   05131 Shigellosis
    81873 (ARPC5L)
   05100 Bacterial invasion of epithelial cells
    81873 (ARPC5L)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    81873 (ARPC5L)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     81873 (ARPC5L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P16-Arc Utp12 UTP15_C
Motif
Other DBs
NCBI-GeneID: 81873
NCBI-ProteinID: NP_112240
HGNC: 23366
Ensembl: ENSG00000136950
Vega: OTTHUMG00000020660
Pharos: Q9BPX5(Tdark)
UniProt: Q9BPX5 A0A024R897 B3KPC7
Position
9q33.3
AA seq 153 aa AA seqDB search
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAA
LRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPT
ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaacacgctgtcctcgcgcttccgccgggtggacatcgacgaatttgacgag
aacaaatttgtggacgagcaggaggaggcggcggcggcggcggcggagccaggcccggac
ccgagcgaggtggacgggctcctgcggcaaggggacatgcttcgggcattccatgcagcc
ttgcggaactctcccgtcaacaccaagaatcaagctgtgaaggagcgagcccagggcgtg
gtgctgaaagtgctcacaaacttcaagagcagtgagattgagcaggctgtgcagtcactg
gacagaaacggcgttgacttgttaatgaagtacatttataaaggctttgagaagcccaca
gaaaatagcagcgcagtgttactccagtggcacgaaaaggccttagcagtaggaggacta
ggctccattataagagttcttacagcaagaaagactgtttaa

DBGET integrated database retrieval system