KEGG   Homo sapiens (human): 8189Help
Entry
8189              CDS       T01001                                 

Gene name
SYMPK, SPK, SYM
Definition
(RefSeq) symplekin
  KO
K06100  
symplekin
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    8189 (SYMPK)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    8189 (SYMPK)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     8189 (SYMPK)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     8189 (SYMPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92797(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 1274 aa AA seqDB search
MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQE
LIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRD
ENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIR
THAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLL
KFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKN
LKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKM
KLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMV
YLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEK
VVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGR
KKIFRLSDVLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQVRIKILASLVTQFNSGL
KAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGASGSLDKYEDCLIRLLSGLQEKPDQK
DGIFTKVVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDL
SSHEKDKVRSQALLFIKRMYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAA
PWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPE
LLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEK
KEVIQALPKLIKLNPIVVKEVFNRLLGTQHGEGNSALSPLNPGELLIALHNIDSVKCDMK
SIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNIL
SRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVR
SFTPHQQAHIPNSIMTILEASGKQEPEAKEAPAGPLEEDDLEPLTLAPAPAPRPPQDLIG
LRLAQEKALKRQLEEEQKLKPGGVGAPSSSSPSPSPSARPGPPPSEEAMDFREEGPECET
PGIFISMDDDSGLTEAALLDSSLEGPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSP
AAEDAREPEAKGNS
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggcagtggagacagcgtcacccgtcggagcgtggcatcacagtttttcact
caagaggaggggccgggcatcgatggcatgaccacctcagagagggtggtggatcttctg
aaccaggcggcgctgatcaccaatgactcaaagatcacagtgctcaaacaggtccaggag
ctgatcatcaacaaagaccccacactactggacaacttcctggatgagatcatcgcattc
caagcagacaagtcaatcgaagtgcgaaaatttgtcatcggcttcatcgaggaggcatgc
aagcgagacattgagttgctgctgaaactcattgcaaacctcaacatgctcttgagggac
gagaatgtgaacgtggtgaagaaggctatcctcaccatgacccagctctacaaggtggcc
ctgcagtggatggtaaagtcacgggtcattagcgagctacaggaggcctgctgggacatg
gtatctgccatggcgggggacatcatcctgctattggactctgacaatgacggcatccgc
acccacgccatcaagtttgtggagggcctcattgtcaccctgtcaccccgcatggctgac
tcagagataccccgacgccaggagcatgatatcagcctggaccgcatccctcgtgaccac
ccctacatccagtacaacgtgctatgggaagagggcaaggcagccttggagcagctgctt
aagttcatggtgcaccctgccatctcctccatcaacctgaccacagcgctgggctccctt
gccaatatcgcccgccagagacccatgttcatgtctgaggtgatccaggcctatgaaact
ctgcatgccaacctgcccccgacgctggccaaatcgcaggtgagcagtgtgcgtaagaat
ctgaagctgcacctgttgagtgtgctgaagcacccggcttccttggagttccaggcccag
atcaccaccctgctggtggacctgggcacacctcaggccgagatcgcccgcaacatgccg
agcagcaaggacacccgcaagcggccccgcgatgactcggactccacactcaagaagatg
aagctggagcccaacctgggggaggacgatgaggacaaagacttggagccaggcccgtcg
gggacctcgaaggcctcagcgcagatctccggccagtcagacacggacatcacagctgag
ttcctgcagcctctgctgacgcctgataatgtggctaatctggtcctcatcagcatggtg
tacctacccgaggccatgccagcctccttccaggccatctacacccccgtggagtcagca
ggcacggaagcccagatcaagcacctggctcggctcatggccacacagatgacagctgcc
ggactgggaccaggtgtagagcagaccaaacagtgcaaggaggagcccaaggaggagaag
gtggtgaagacagagagcgtcctgatcaagcggcgcctgtcagcccagggccaagccatc
tcggtggtgggttccctgagctccatgtcccccctggaggaagaggcaccgcaggccaag
aggaggccagagcccattatccctgtcactcagccccggctggcaggcgctggtgggcgc
aagaaaattttccgtctcagcgacgtgctgaagccccttaccgatgcccaggtggaagcc
atgaagctgggcgctgtgaagcggatcctgcgggctgagaaggctgtggcctgcagcggg
gcagcccaggtccgcataaagatcctggccagcctggtgacacagttcaactcgggcctg
aaggcggaggtcctgtccttcatcctggaggatgtgcgggcccgcctggacctggccttc
gcctggctctaccaggagtacaacgcctacctggccgcaggtgcctcgggctccctggac
aagtatgaggactgcctcatccgcctgttgtctggcctgcaggagaaaccagaccagaag
gatgggatcttcaccaaggttgtgctggaggcgccactcatcacagagagtgccctggag
gtggtccgcaagtactgcgaggatgagagtcgcacctatctgggcatgtccacacttcga
gacctgatcttcaagcgcccgtcccgccagttccagtacctgcatgtcctcctcgacctc
agctcccatgagaaggacaaggtgcgctcccaggccctgctgttcatcaaacgcatgtat
gagaaggagcagctgcgggagtatgtggagaaatttgccctcaactacctgcagctcctg
gtgcaccccaacccaccgtctgtgctgtttggagctgacaaggacacagaggtggcagca
ccctggacggaggagacagtgaagcagtgtctgtacctctacctggccctcctgcctcag
aaccacaagctgatccacgaactggcggccgtgtacactgaagccatcgccgacatcaag
cggacggtgctgagggtcattgagcagccgatccgaggaatgggcatgaactccccggag
ctgctcctgctggtggaaaattgtcccaagggagcagagacactggtcacgagatgtctg
cacagcctcacagacaaagtcccaccctccccagagctggtgaagcgggtccgggatctc
taccacaagcgactgccagacgtccgcttcctcatcccggtgctcaatgggctggagaag
aaagaggtgatccaggccctgcctaaactcatcaaactcaaccccatcgtggtgaaggaa
gtcttcaaccgcctgctgggcacccagcatggtgagggaaactcagccttgtccccgctg
aaccctggagagctcctgatcgcattacacaacattgactccgtgaagtgcgacatgaaa
tccatcatcaaagccaccaacctgtgctttgcggagcggaacgtgtacacgtcagaggtg
ctggccgtggtgatgcagcagctgatggagcagagccccctgcccatgctgctcatgagg
accgtcatccagtccctgaccatgtacccccgcctggggggcttcgtcatgaacatcctg
tcccgcctcatcatgaagcaggtgtggaagtaccccaaggtgtgggagggcttcatcaag
tgctgccagcgcacaaagccccagagcttccaggtcatcctgcagctgccgccccagcag
ctgggagccgtctttgacaagtgcccagagctccgggagcccctgctggcccatgtccgc
tccttcaccccccaccagcaagctcacatccctaactccatcatgaccatcttggaggcc
agcggcaagcaggagccagaggccaaggaggcgcctgcggggcccttggaggaggatgat
ctggagcccctgaccttggccccggccccagcaccccggccccctcaggacctcatcggc
ctgcgactggcccaggagaaggccttaaagcggcagctggaggaggaacagaagctgaag
ccgggaggagtgggagccccctcctcttcctccccctctccctctccgtcggcccggcca
ggcccgcccccgtctgaggaagccatggatttccgggaggaggggcctgagtgcgagacc
ccgggcatcttcatcagcatggatgacgactcggggctgaccgaggccgcgctgttggac
tctagtctcgagggccccctacccaaggagacggcagcgggcgggctgaccttgaaggag
gagcggagcccccagaccctcgcacctgttggagaagatgctatgaagactcccagcccg
gctgccgaggacgccagggaacccgaggccaaggggaacagctga

DBGET integrated database retrieval system