KEGG   Homo sapiens (human): 820Help
Entry
820               CDS       T01001                                 

Gene name
CAMP, CAP-18, CAP18, CRAMP, FALL-39, FALL39, LL37
Definition
cathelicidin antimicrobial peptide
Orthology
K13916  
cathelicidin antimicrobial peptide
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Tuberculosis
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 173 aa AA seqDB search
MGTMKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYR
LLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQA
RGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggggaccatgaagacccaaagggatggccactccctggggcggtggtcactggtgctc
ctgctgctgggcctggtgatgcctctggccatcattgcccaggtcctcagctacaaggaa
gctgtgcttcgtgctatagatggcatcaaccagcggtcctcggatgctaacctctaccgc
ctcctggacctggaccccaggcccacgatggatggggacccagacacgccaaagcctgtg
agcttcacagtgaaggagacagtgtgccccaggacgacacagcagtcaccagaggattgt
gacttcaagaaggacgggctggtgaagcggtgtatggggacagtgaccctcaaccaggcc
aggggctcctttgacatcagttgtgataaggataacaagagatttgccctgctgggtgat
ttcttccggaaatctaaagagaagattggcaaagagtttaaaagaattgtccagagaatc
aaggattttttgcggaatcttgtacccaggacagagtcctag

DBGET integrated database retrieval system