KEGG   Homo sapiens (human): 8200Help
Entry
8200              CDS       T01001                                 

Gene name
GDF5, BDA1C, BMP-14, BMP14, CDMP1, LAP-4, LAP4, OS5, SYM1B, SYNS2
Definition
growth differentiation factor 5
Orthology
K04664  
growth differentiation factor 5/6/7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway
Disease
H00466  
Grebe dysplasia
H00467  
Fibular hypoplasia and complex brachydactyly
H00483  
Brachydactyly
H00484  
Other brachydactylies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    8200 (GDF5)
   04390 Hippo signaling pathway
    8200 (GDF5)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8200 (GDF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2
AA seq 501 aa AA seqDB search
MRLPKLLTFLLWYLAWLDLEFICTVLGAPDLGQRPQGTRPGLAKAEAKERPPLARNVFRP
GGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATAR
TVTPKGQLPGGKAPPKAGSVPSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSLYRTL
SDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKDGLLGAELR
ILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLF
RNFKNSAQLCLELEAWERGRAVDLRGLGFDRAARQVHEKALFLVFGRTKKRDLFFNEIKA
RSGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA
PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFID
SANNVVYKQYEDMVVESCGCR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagactccccaaactcctcactttcttgctttggtacctggcttggctggacctggaa
ttcatctgcactgtgttgggtgcccctgacttgggccagagaccccaggggaccaggcca
ggattggccaaagcagaggccaaggagaggccccccctggcccggaacgtcttcaggcca
gggggtcacagctatggtgggggggccaccaatgccaatgccagggcaaagggaggcacc
gggcagacaggaggcctgacacagcccaagaaggatgaacccaaaaagctgccccccaga
ccgggcggccctgaacccaagccaggacaccctccccaaacaaggcaggctacagcccgg
actgtgaccccaaaaggacagcttcccggaggcaaggcacccccaaaagcaggatctgtc
cccagctccttcctgctgaagaaggccagggagcccgggcccccacgagagcccaaggag
ccgtttcgcccaccccccatcacaccccacgagtacatgctctcgctgtacaggacgctg
tccgatgctgacagaaagggaggcaacagcagcgtgaagttggaggctggcctggccaac
accatcaccagctttattgacaaagggcaagatgaccgaggtcccgtggtcaggaagcag
aggtacgtgtttgacattagtgccctggagaaggatgggctgctgggggccgagctgcgg
atcttgcggaagaagccctcggacacggccaagccagcggcccccggaggcgggcgggct
gcccagctgaagctgtccagctgccccagcggccggcagccggccgccttgctggatgtg
cgctccgtgccaggcctggacggatctggctgggaggtgttcgacatctggaagctcttc
cgaaactttaagaactcggcccagctgtgcctggagctggaggcctgggaacggggcagg
gccgtggacctccgtggcctgggcttcgaccgcgccgcccggcaggtccacgagaaagcc
ctgttcctggtgtttggccgcaccaagaaacgggacctgttctttaatgagattaaggcc
cgctctggccaggacgataagaccgtgtatgagtacctgttcagccagcggcgaaaacgg
cgggccccactggccactcgccagggcaagcgacccagcaagaaccttaaggctcgctgc
agtcggaaggcactgcatgtcaacttcaaggacatgggctgggacgactggatcatcgca
ccccttgagtacgaggctttccactgcgaggggctgtgcgagttcccattgcgctcccac
ctggagcccacgaatcatgcagtcatccagaccctgatgaactccatggaccccgagtcc
acaccacccacctgctgtgtgcccacgcggctgagtcccatcagcatcctcttcattgac
tctgccaacaacgtggtgtataagcagtatgaggacatggtcgtggagtcgtgtggctgc
aggtag

DBGET integrated database retrieval system