KEGG   Homo sapiens (human): 8218Help
Entry
8218              CDS       T01001                                 

Gene name
CLTCL1, CHC22, CLH22, CLTCL, CLTD
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    8218 (CLTCL1)
   04142 Lysosome
    8218 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    8218 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    8218 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    8218 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    8218 (CLTCL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   8218 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 1583 aa AA seqDB search
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
MDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQDAMQHAAESRDAELAQKLLQWF
LEEGKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALE
SLRKQEEHVTEPAPLVFDFDGHE
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccctgttcgctttcaggagcacttccagctccaaaaccttggaatt
aatccagctaacattggattcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagttggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccagcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcatactatggcagaagaagtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagaccgcggtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgatagacataccagtctggtgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctgctcgtaggcatctcggctcagcaaaaccgtgtggttggagca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgctgcggct
tttgcagagttcaagatggaggggaatgccaagcctgccacccttttctgctttgctgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaagaaagcagtagatgtgttttttcctccagaggcacagaatgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtacgacctagagtctggcgtgtgcatctgcatgaaccgtattagtgct
gacacaatatttgtcactgctccacacaaaccaacctctggaattattggtgtcaacaaa
aagggacaggtactgtcagtttgtgttgaggaagataacattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccgttcgtagtaacctggctggggca
gagaagttgtttgtgagaaaattcaataccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcgtctgcaccaaagggaatcctgcgtaccagagagacggtccagaaa
ttccagagtatacccgctcagtctggccaggcttctccattgctgcagtacttcggaatc
ctgctcgaccagggtcagctcaataaacttgaatccttagaactttgccatctggttctt
cagcaggggcgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaatgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgaggggt
gtaatgaagatcagtccggaacagggcctgcagttttctcgaatgctagtgcaggacgag
gagccgctggccaacattagccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccagctgagggactcctg
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataaaatgtttactcattacgaccgggcccacattgcccagctctgtgagaaggca
ggcctcctgcagcaagcactggagcactacaccgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttctttggctccttatcggtg
gaggattctgtggagtgtctgcatgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccacgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttacaaaggcctcttctacttcctgggctcaatcgtgaac
ttcagccaagacccagatgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgtgatcgt
tttggctttgtccatgaccttgtcctatatttataccgcaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtgattggagggctgctt
gatgtggattgttctgaggaagtgattaaacacttaatcatggcagtgagaggacagttc
tctactgatgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccagattcaggaaggctgtgaggagcctgccactcacaatgcactggct
aaaatctacatcgacagcaacaacagccccgagtgcttcctgagagagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaagcgagacccccatctggcctgtgttgcc
tatgagcgggggcagtgtgaccttgagctcatcaaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtatgcagaaaggatccggagctctgggctcacgtcctt
gaggagaccaacccatccaggagacagctaattgaccaggtggtacagacagcattgtca
gaaacacgggatcctgaagagatttcggtcactgtcaaagcctttatgacagccgacctg
cctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcagcgag
cacaggaatctacagaatctgttgatcctgactgccatcaaggcagaccgcacacgggtc
atggagtacatcagccgcctggacaactatgacgcactggacatcgcgagcatcgctgtc
agcagcgcactgtatgaggaggccttcaccgttttccacaagtttgatatgaatgcctca
gcaatccaggtcctgatcgagcacattggaaacctggaccgggcatatgagtttgcggag
agatgcaatgagcctgctgtgtggagtcagctggcccaagcccagctccagaaagatttg
gtgaaggaagccatcaactcctatatcagaggggacgacccttcctcttacctggaagtt
gttcagtcagccagcaggagcaacaactgggaggatctagttaaatttctgcagatggcc
aggaaaaagggccgtgagtcctatatagagactgaacttatttttgccttggctaaaacc
agccgtgtttctgagctagaagattttattaatggacccaacaatgcccacatccagcag
gttggagaccgctgttacgaggagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacgtggaaggaggtgtgctttgcctgc
atggatggacaagagttccgcttcgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgtggctactttgaggagctgatc
ttgctgttggaagcggccctgggcctggagcgggcccacatgggcatgttcactgagctg
gccatcctctactccaaattcaagccacagaagatgctggagcatctggagcttttctgg
tcccgtgtcaacatcccaaaggtgctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtatgacaatgctgtgctcaccatgatgagc
caccccactgaggcctggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gtcgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacctgctgctggtgctttcaccccggctggaccacacctggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcactcaaccacctgctgacagaggaggaggactatcaggatgcc
atgcagcatgctgcagagtcgcgggatgctgagctggcccagaagttgctgcagtggttc
ctggaggaaggcaagagggagtgcttcgcagcttgtctcttcacctgctatgacctgctt
cgcccagacatggtgcttgagctggcctggaggcacaacctcgtggacttggccatgccc
tacttcatccaggtgatgagggagtacctgagcaaggtggacaaactggatgccttggag
agtctgcgcaagcaagaggagcatgtgacagagcctgcccctctcgtgtttgattttgat
gggcatgaatga

DBGET integrated database retrieval system