KEGG   Homo sapiens (human): 8241Help
Entry
8241              CDS       T01001                                 

Gene name
RBM10, DXS8237E, GPATC9, GPATCH9, S1-1, TARPS, ZRANB5
Definition
(RefSeq) RNA binding motif protein 10
  KO
K13094  
RNA-binding protein 5/10
Organism
hsa  Homo sapiens (human)
Disease
H00943  
TARP syndrome
Brite
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    8241 (RBM10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 930 aa AA seqDB search
MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDS
SEEQSAEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEED
EEEEEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSH
LQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPK
SEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENAND
TIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLL
QILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG
GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGP
EASLEPGADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQ
SPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNA
QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWAR
SLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDD
RPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQL
SGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG
ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLG
ARGSSYGVTSTESYKETLHKTMVTRFNEAQ
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgaaagacgtggtggtcgtggtgacaggactggccgctatggagccactgac
cgctcgcaggatgatggtggggagaaccgcagccgagaccacgactaccgggacatggac
taccgttcatatcctcgcgagtatggcagccaggagggcaagcatgactatgacgactca
tctgaggagcagagtgcggaggattcctacgaggcctccccgggctccgagactcagcgt
aggcggcggcggcggcacaggcacagccccaccggcccgccaggcttcccccgagacggc
gactatcgggaccaggactatcggaccgagcaaggggaggaggaggaggaggaggaggat
gaggaggaggaggagaaggccagtaacatcgtcatgctgaggatgctgccacaggcagcc
actgaggatgacatccgtggccagctgcagtcgcacggcgtgcaagcacgggaggttcgg
ctgatgcggaacaaatcttcaggtcagagccggggcttcgccttcgtcgagtttagtcac
ttgcaggacgctacacgatggatggaagccaatcagcactccctcaacatcctgggccag
aaggtgtcgatgcactacagtgaccccaagcccaagatcaatgaggactggctgtgcaat
aagtgtggcgtccagaacttcaaacgccgagagaagtgcttcaaatgtggcgtgcccaag
tcagaggcagagcagaagctgcccctcggcacgaggctggatcagcagacactgccactg
ggtggccgggagctgagccagggcctgcttcccctgccgcagccctaccaggcccaggga
gtcctggcctcccaagccctgtcacagggctcggagccaagctcagagaacgccaatgac
accatcattttgcgcaacctgaacccacacagcaccatggattccatcctgggggccctg
gcaccctacgcggtgctgtcctcctccaacgtgcgcgtcataaaggacaagcagacccaa
ctgaaccgcggctttgccttcatccagctctccaccatcgtggaggcagcccagctgctg
cagatcctgcaggccctgcacccaccactcactatcgacggcaagaccatcaatgttgag
tttgccaagggttctaagagggacatggcctccaatgaaggcagtcgcatcagtgctgcc
tctgtggccagcactgccattgctgcggcccagtgggccatctcacaggcctcccaaggt
ggggagggtacctgggccacctccgaggagccgccggtcgactacagctactaccaacag
gatgagggctatggcaacagccagggcacagagtcttccctctatgcccatggctacctc
aagggcaccaagggccctggcatcactggaaccaaaggggatcccactggagcaggtccc
gaggcctccctagagcctggggccgactctgtgtcgatgcaggctttctctcgcgcccag
cctggtgctgctcctggcatctaccaacaatcagccgaggcgagcagtagccagggcact
gctgccaacagccagtcgtataccatcatgtcacccgctgtgctcaaatctgagctccag
agccctacccatcctagttctgctctcccaccggctaccagccccactgcccaggaatcc
tacagccagtaccctgttcccgacgtctctacctaccagtacgatgagacctccggctac
tactatgacccccagaccggcctctactatgaccccaactcccagtattactacaatgct
cagagccagcagtacctgtactgggatggggagaggcggacctatgttcccgccctggag
cagtcggccgacggacataaggagacaggggcaccctcgaaggagggcaaagagaagaag
gagaagcacaagaccaagacagctcaacagattgccaaggacatggaacgctgggcccgc
agtctcaacaaacaaaaagaaaacttcaaaaatagcttccagcctatcagctccctgcga
gatgacgagaggcgggagtcagccactgcagatgctggctatgccatcctcgagaagaag
ggagcactagccgagagacagcacaccagcatggatctcccgaaattggccagtgacgac
cgcccaagccctccgcgaggactggtggcagcctacagcggggagagtgacagtgaggag
gagcaggagcgtgggggccctgagcgggaggagaagctcaccgactggcagaagctggcc
tgtctgctctgccgacgccagttccccagcaaagaggcgctcatccggcaccagcagctc
tcagggctccacaagcaaaaccttgagattcaccggcgagcccacttgtcagaaaacgag
ctagaagcactagagaagaatgacatggagcaaatgaagtaccgggaccgtgcagctgaa
cgcagagaaaagtatggcatccccgagccgccagagcccaagaggaggaagtacggcggc
atatccacagcctctgtagacttcgagcagcctactcgggacgggctgggcagtgacaac
attggcagtcggatgctgcaggccatgggctggaaagagggcagcggcctgggccgcaag
aagcagggcattgtaacgcctatcgaggcccaaacacgggtgcggggctccggcctgggt
gcacggggcagctcctacggggtcacctcaaccgagtcctacaaggagacactgcacaag
acaatggtgacccgcttcaacgaggcccagtga

DBGET integrated database retrieval system