KEGG   Homo sapiens (human): 825Help
Entry
825               CDS       T01001                                 

Gene name
CAPN3, CANP3, CANPL3, LGMD2, LGMD2A, nCL-1, p94
Definition
(RefSeq) calpain 3
  KO
K08573  
calpain-3 [EC:3.4.22.54]
Organism
hsa  Homo sapiens (human)
Disease
H00592  
Calpainopathy
H00593  
Limb-girdle muscular dystrophy (LGMD)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.54  calpain-3
     825 (CAPN3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   825 (CAPN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P20807(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
15q15.1
AA seq 821 aa AA seqDB search
MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKT
FEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTD
ICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFE
IRDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQ
DSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPW
GQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADA
LQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSF
LVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM
REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTK
PIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQ
IAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHL
WNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFD
SFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtcattagcgcatctgtggctccaaggacagcggctgagccccggtcccca
gggccagttcctcacccggcccagagcaaggccactgaggctgggggtggaaacccaagt
ggcatctattcagccatcatcagccgcaattttcctattatcggagtgaaagagaagaca
ttcgagcaacttcacaagaaatgtctagaaaagaaagttctttatgtggaccctgagttc
ccaccggatgagacctctctcttttatagccagaagttccccatccagttcgtctggaag
agacctccggaaatttgcgagaatccccgatttatcattgatggagccaacagaactgac
atctgtcaaggagagctaggggactgctggtttctcgcagccattgcctgcctgaccctg
aaccagcaccttcttttccgagtcataccccatgatcaaagtttcatcgaaaactacgca
gggatcttccacttccagttctggcgctatggagagtgggtggacgtggttatagatgac
tgcctgccaacgtacaacaatcaactggttttcaccaagtccaaccaccgcaatgagttc
tggagtgctctgctggagaaggcttatgctaagctccatggttcctacgaagctctgaaa
ggtgggaacaccacagaggccatggaggacttcacaggaggggtggcagagttttttgag
atcagggatgctcctagtgacatgtacaagatcatgaagaaagccatcgagagaggctcc
ctcatgggctgctccattgatgatggcacgaacatgacctatggaacctctccttctggt
ctgaacatgggggagttgattgcacggatggtaaggaatatggataactcactgctccag
gactcagacctcgaccccagaggctcagatgaaagaccgacccggacaatcattccggtt
cagtatgagacaagaatggcctgcgggctggtcagaggtcacgcctactctgtcacgggg
ctggatgaggtcccgttcaaaggtgagaaagtgaagctggtgcggctgcggaatccgtgg
ggccaggtggagtggaacggttcttggagtgatagatggaaggactggagctttgtggac
aaagatgagaaggcccgtctgcagcaccaggtcactgaggatggagagttctggatgtcc
tatgaggatttcatctaccatttcacaaagttggagatctgcaacctcacggccgatgct
ctgcagtctgacaagcttcagacctggacagtgtctgtgaacgagggccgctgggtacgg
ggttgctctgccggaggctgccgcaacttcccagatactttctggaccaaccctcagtac
cgtctgaagctcctggaggaggacgatgaccctgatgactcggaggtgatttgcagcttc
ctggtggccctgatgcagaagaaccggcggaaggaccggaagctaggggccagtctcttc
accattggcttcgccatctacgaggttcccaaagagatgcacgggaacaagcagcacctg
cagaaggacttcttcctgtacaacgcctccaaggccaggagcaaaacctacatcaacatg
cgggaggtgtcccagcgcttccgcctgcctcccagcgagtacgtcatcgtgccctccacc
tacgagccccaccaggagggggaattcatcctccgggtcttctctgaaaagaggaacctc
tctgaggaagttgaaaataccatctccgtggatcggccagtgaaaaagaaaaaaaccaag
cccatcatcttcgtttcggacagagcaaacagcaacaaggagctgggtgtggaccaggag
tcagaggagggcaaaggcaaaacaagccctgataagcaaaagcagtccccacagccacag
cctggcagctctgatcaggaaagtgaggaacagcaacaattccggaacattttcaagcag
atagcaggagatgacatggagatctgtgcagatgagctcaagaaggtccttaacacagtc
gtgaacaaacacaaggacctgaagacacacgggttcacactggagtcctgccgtagcatg
attgcgctcatggatacagatggctctggaaagctcaacctgcaggagttccaccacctc
tggaacaagattaaggcctggcagaaaattttcaaacactatgacacagaccagtccggc
accatcaacagctacgagatgcgaaatgcagtcaacgacgcaggattccacctcaacaac
cagctctatgacatcattaccatgcggtacgcagacaaacacatgaacatcgactttgac
agtttcatctgctgcttcgttaggctggagggcatgttcagagcttttcatgcatttgac
aaggatggagatggtatcatcaagctcaacgttctggagtggctgcagctcaccatgtat
gcctga

DBGET integrated database retrieval system