KEGG   Homo sapiens (human): 826Help
Entry
826               CDS       T01001                                 

Gene name
CAPNS1, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1
Definition
(RefSeq) calpain small subunit 1 (EC:3.4.22.17)
  KO
K08583  
calpain, small subunit 1
Organism
hsa  Homo sapiens (human)
Brite
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   826 (CAPNS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.12
AA seq 268 aa AA seqDB search
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR
ILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATEL
MNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQ
FDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMF
RAFKSLDKDGTGQIQVNIQEWLQLTMYS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttcctggttaactcgttcttgaagggcggcggcggcggcggcgggggaggcgggggc
ctgggtgggggcctgggaaatgtgcttggaggcctgatcagcggggccgggggcggcggc
ggcggcggcggcggcggcggcggtggtggaggcggcggtggcggtggaacggccatgcgc
atcctaggcggagtcatcagcgccatcagcgaggcggctgcgcagtacaacccggagccc
ccgcccccacgcacacattactccaacattgaggccaacgagagtgaggaggtccggcag
ttccggagactctttgcccagctggctggagatgacatggaggtcagcgccacagaactc
atgaacattctcaataaggttgtgacacgacaccctgatctgaagactgatggttttggc
attgacacatgtcgcagcatggtggccgtgatggatagcgacaccacaggcaagctgggc
tttgaggaattcaagtacttgtggaacaacatcaaaaggtggcaggccatatacaaacag
ttcgacactgaccgatcagggaccatttgcagtagtgaactcccaggtgcctttgaggca
gcagggttccacctgaatgagcatctctataacatgatcatccgacgctactcagatgaa
agtgggaacatggattttgacaacttcatcagctgcttggtcaggctggacgccatgttc
cgtgccttcaaatctcttgacaaagatggcactggacaaatccaggtgaacatccaggag
tggctgcagctgactatgtattcctga

DBGET integrated database retrieval system