KEGG   Homo sapiens (human): 8273Help
Entry
8273              CDS       T01001                                 

Gene name
SLC10A3, DXS253E, P3
Definition
(RefSeq) solute carrier family 10 member 3
  KO
K14343  
solute carrier family 10 (sodium/bile acid cotransporter), member 3/5
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC10: Sodium bile salt cotransporter
   8273 (SLC10A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 477 aa AA seqDB search
MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQGTASTSLSTAGGHTVPP
TGGRYLSIGDGSVMEFEFPEDSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNV
SAITWGGGGGFVVSIHSGLAGLAPLHIQLVDAHEAPPTLIEERRDFCIKVSPAEDTPATL
SADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQSPQPMLLGLLGQFLVMPLY
AFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLP
LSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSF
VLLLGGLFLAYRMGVFILAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIE
VGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGHFIYSSLFPVP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtgttaatgcaggacaagggcagctctcagcagtggcctggtctggggggcgagggt
ggtggcacaggtcccttaagcatgctcagagctgccctgctgctcatcagcctgccatgg
ggggcccaagggacagccagcaccagcctcagcactgctgggggtcacaccgtgccaccg
actgggggccgctacttgagcattggagatggctctgtgatggagtttgagtttcctgag
gacagtgagggcatcatcgtgatctccagccagtacccaggccaggccaacaggacggcg
cctggccccatgctcagggtcacctccctggacacagaggtgctgaccatcaagaacgtg
agtgctataacctggggaggcgggggtggctttgtggtgagcatccactcaggcctggct
gggctggccccactccacatccagctcgtggacgcccatgaggccccgcccacactgatt
gaggagcggagagacttctgcatcaaggtctcacctgctgaagacacgcctgccaccctc
agcgccgacctggcccacttctcggaaaacccaatcctctacctgctcctgcctcttatc
tttgtcaacaagtgttcgtttgggtgcaaagtggaactcgaggttctgaaggggctcatg
cagagcccccagcccatgctgctgggcctcctgggccagtttctggtcatgcccttgtac
gctttcctcatggccaaggtcttcatgctgcccaaggccctggctctgggcctcatcatc
acctgctcgtcgcctggcggcggggggagctacctcttcagcctccttcttggaggggac
gtcaccctggccatctccatgactttcctctctacggtggctgccactggcttcttgcct
ctgtcttcggccatctacagccgcctgctcagcatccatgagacgctccacgtgcccatc
tccaagatcctggggaccctgctgttcattgccatccccatagccgtgggcgtgctgatc
aagtccaagctccccaagttctcccagctgctgctgcaggtcgtcaagcccttcagcttt
gtgctcctcctgggcggcctcttcctggcctatcgcatgggggtcttcatcctggcaggc
atccggctacccatcgtactggtgggtatcacggtgcccctggttggcctgttggtgggc
tactgcctagccacgtgtctgaagctgccagtggcccagcggcggacggtcagcattgag
gtaggggtgcagaacagcctgctggccttggccatgctgcagctatccctccgccgcctt
caagctgactatgcctcccaggcccccttcattgtggcgctgagcggcacctccgagatg
ctggccttggtcattggccacttcatctacagcagcctgttcccagttccctga

DBGET integrated database retrieval system