KEGG   Homo sapiens (human): 8292Help
Entry
8292              CDS       T01001                                 

Gene name
COLQ, CMS5, EAD
Definition
(RefSeq) collagen like tail subunit of asymmetric acetylcholinesterase
Organism
hsa  Homo sapiens (human)
Disease
H00770  
Congenital myasthenic syndrome
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 455 aa AA seqDB search
MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPP
LFPPPFFRGGRSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKG
EKGELGRPGRKGRPGPPGVPGMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPG
SRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQG
QKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGERGFPGPPGRCLCGPTMNVN
NPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLT
PFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGS
DFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcctgaatccaatgactttgggaatttatcttcagcttttcttcctctctatc
gtgtctcagccgactttcatcaacagcgttcttccaatctcagcagcccttcccagcctg
gatcagaagaagcgtggtggccacaaagcatgctgcctgctgacgcctcctccaccacca
ctgttcccaccaccattcttcagaggtggccgaagtccgcttctctccccagacatgaag
aatctcatgctggaactggagacctcgcagtccccgtgcatgcaaggctcgctaggctcc
cctgggcctcccggcccccagggtccaccggggcttcctggcaagacaggaccaaaggga
gaaaagggggagcttggccgaccaggaaggaagggtagacctggccccccaggtgttcct
ggcatgcctgggcccatcggttggccaggccctgaaggacccaggggtgaaaaaggtgac
ctgggtatgatgggcttgccagggtcaagaggaccaatgggctccaagggctaccctgga
tccagaggggaaaagggatccagaggtgaaaagggtgacctgggtcccaaaggagaaaag
ggtttcccaggatttcctggaatgttggggcagaaaggtgaaatgggtccaaaaggtgaa
cctgggatagcaggacaccgaggacccacaggaagaccaggaaaacgaggcaagcaggga
cagaaaggggatagtggagttatgggcccaccaggcaagcctgggccttctggtcaacct
ggccgtccggggcccccaggccccccacctgcaggacaacttataatgggacccaaaggg
gaaagaggatttcccgggcctccaggaagatgtctttgtggacccactatgaatgtgaat
aacccttcctacggggaatctgtgtatgggcccagttccccgcgagttcctgtgattttt
gtggtcaacaaccaggaggagcttgagaggctgaacacccaaaacgccattgccttccgc
agagaccagagatctctgtacttcaaggacagccttggctggctccccatccagctgacc
cctttctaccctgtggattacactgcagaccagcacggcacctgtggggatgggctcctg
cagcctggggaggagtgtgacgacggtaacagcgatgtgggtgacgactgcatccgctgt
caccgtgcctactgtggagatggtcaccggcatgagggtgtggaggactgtgacggctct
gactttggctacctgacatgcgagacctatctccctgggtcatatggagacctgcaatgc
acccagtactgctacatcgactccacgccctgccgctacttcacctga

DBGET integrated database retrieval system