KEGG   Homo sapiens (human): 8292Help
Entry
8292              CDS       T01001                                 

Gene name
COLQ, EAD
Definition
collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Organism
hsa  Homo sapiens (human)
Disease
H00770  
Congenital myasthenic syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25
AA seq 455 aa AA seqDB search
MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPP
LFPPPFFRGGRSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKG
EKGELGRPGRKGRPGPPGVPGMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPG
SRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQG
QKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGERGFPGPPGRCLCGPTMNVN
NPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLT
PFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGS
DFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcctgaatccaatgactttgggaatttatcttcagcttttcttcctctctatc
gtgtctcagccgactttcatcaacagcgttcttccaatctcagcagcccttcccagcctg
gatcagaagaagcgtggtggccacaaagcatgctgcctgctgacgcctcctccaccacca
ctgttcccaccaccattcttcagaggtggccgaagtccgcttctctccccagacatgaag
aatctcatgctggaactggagacctcgcagtccccgtgcatgcaaggctcgctaggctcc
cctgggcctcccggcccccagggtccaccggggcttcctggcaagacaggaccaaaggga
gaaaagggggagcttggccgaccaggaaggaagggtagacctggccccccaggtgttcct
ggcatgcctgggcccatcggttggccaggccctgaaggacccaggggtgaaaaaggtgac
ctgggtatgatgggcttgccagggtcaagaggaccaatgggctccaagggctaccctgga
tccagaggggaaaagggatccagaggtgaaaagggtgacctgggtcccaaaggagaaaag
ggtttcccaggatttcctggaatgttggggcagaaaggtgaaatgggtccaaaaggtgaa
cctgggatagcaggacaccgaggacccacaggaagaccaggaaaacgaggcaagcaggga
cagaaaggggatagtggagttatgggcccaccaggcaagcctgggccttctggtcaacct
ggccgtccggggcccccaggccccccacctgcaggacaacttataatgggacccaaaggg
gaaagaggatttcccgggcctccaggaagatgtctttgtggacccactatgaatgtgaat
aacccttcctacggggaatctgtgtatgggcccagttccccgcgagttcctgtgattttt
gtggtcaacaaccaggaggagcttgagaggctgaacacccaaaacgccattgccttccgc
agagaccagagatctctgtacttcaaggacagccttggctggctccccatccagctgacc
cctttctaccctgtggattacactgcagaccagcacggcacctgtggggatgggctcctg
cagcctggggaggagtgtgacgacggtaacagcgatgtgggtgacgactgcatccgctgt
caccgtgcctactgtggagatggtcaccggcatgagggtgtggaggactgtgacggctct
gactttggctacctgacatgcgagacctatctccctgggtcatatggagacctgcaatgc
acccagtactgctacatcgactccacgccctgccgctacttcacctga

DBGET integrated database retrieval system