KEGG   Homo sapiens (human): 830Help
Entry
830               CDS       T01001                                 

Gene name
CAPZA2, CAPPA2, CAPZ
Definition
(RefSeq) capping actin protein of muscle Z-line alpha subunit 2
  KO
K10364  
capping protein (actin filament) muscle Z-line, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    830 (CAPZA2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     830 (CAPZA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   830 (CAPZA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
7q31.2-q31.3
AA seq 286 aa AA seqDB search
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcggatctggaggagcagttgtctgatgaagagaaggtgcgtatagcagcaaaattc
atcattcatgcccctcctggagaatttaatgaggttttcaatgatgttcggttactgctt
aataatgacaatcttctcagggaaggagcagcccatgcatttgcacagtataacttggac
cagtttactccagtaaaaattgaaggttatgaagatcaggtattgataacagaacatggc
gacttgggaaatggaaagtttttggatccaaagaacagaatctgttttaaatttgatcac
ttaaggaaggaggcaactgatccaagaccctgtgaagtagaaaatgcagttgaatcatgg
agaacttcagtagaaactgctctgagagcttacgtaaaagaacattacccgaatggagtc
tgcactgtgtatggcaaaaaaatagatggacagcaaaccattattgcatgcatagaaagc
catcagttccaagcaaaaaatttttggaatggtcgttggaggtcagaatggaagtttaca
atcactccttcaaccactcaagtggttggcatcttgaaaattcaggttcattattatgaa
gatggtaatgttcagctagtgagtcataaagatatacaagattccctaacagtgtctaat
gaagtgcaaacagcaaaagaatttataaagattgtagaagctgcagaaaatgaataccag
actgccatcagtgagaattatcagacaatgtcggacactactttcaaagccttacgtcga
cagttgccagttacacgcactaagattgattggaacaagatccttagctacaagattggc
aaagagatgcagaatgcataa

DBGET integrated database retrieval system