KEGG   Homo sapiens (human): 8309Help
Entry
8309              CDS       T01001                                 

Gene name
ACOX2, BCOX, BRCACOX, BRCOX, THCCox
Definition
acyl-CoA oxidase 2, branched chain (EC:1.17.99.3)
Orthology
K10214  
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase [EC:1.17.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
PPAR signaling pathway
Peroxisome
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    8309 (ACOX2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    8309 (ACOX2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    8309 (ACOX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With other, unknown, acceptors
    1.17.99.3  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase
     8309 (ACOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p14.3
AA seq 681 aa AA seqDB search
MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSY
PEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIHR
VFVRALRSLGSEEQIAKWDPLCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFVI
HSPTLTATKWWPGDLGRSATHALVQAQLICSGARRGMHAFIVPIRSLQDHTPLPGIIIGD
IGPKMDFDQTDNGFLQLNHVRVPRENMLSRFAQVLPDGTYVKLGTAQSNYLPMVVVRVEL
LSGEILPILQKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQLAISYAFHFL
AVSLLEFFQHSYTAILNQDFSFLPELHALSTGMKAMMSEFCTQGAEMCRRACGGHGYSKL
SGLPSLVTKLSASCTYEGENTVLYLQVARFLVKSYLQTQMSPGSTPQRSLSPSVAYLTAP
DLARCPAQRAADFLCPELYTTAWAHVAVRLIKDSVQHLQTLTQSGADQHEAWNQTTVIHL
QAAKVHCYYVTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGA
QVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNT
QENPAYEEYIRPLLQSWRSKL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccagtgcaccgagtgtcattgggggatacctggagcaggcaaatgcacccc
gacatagagagcgagaggtatatgcagtcctttgacgtggaacggctcaccaacatcctt
gatggaggtgcccagaacactgcactccgcaggaaagttgagagcatcatccacagttac
ccggagtttagctgtaaggacaattatttcatgacccagaatgagcgttataaggctgcc
atgcggagggcattccacatccggttgatagctcggcgcctgggttggttagaagatggt
cgtgaattaggctacgcttacagagccctttctggagacgtggccttaaatatacacaga
gtcttcgtgagagccctcaggagcctgggctcagaggagcagattgccaaatgggaccca
ctctgcaaaaacatccagatcatcgcaacgtatgcacagacagagttgggacatgggaca
tatcttcagggcctggagactgaagccacctatgacgcagccacccaggagtttgtgata
cacagccccacgctgactgccaccaaatggtggcctggagacttgggacggtcagccacc
catgccctggtccaggcccagctgatctgctcaggagccaggcggggcatgcacgctttt
attgtgccaatccggagtcttcaggaccacaccccactgccaggaatcatcattggggac
atcggacccaagatggactttgatcaaacagacaatggcttcctgcagctgaaccatgtg
cgggtccccagggagaacatgctgagtcgctttgcacaggtcttgccagatggcacctac
gtcaaactcggtacagcacagagcaactaccttcccatggtggtggtgcgggtggagctg
ctgtcaggggagatcctccctatactgcagaaggcctgtgtcatcgccatgcgctactcg
gtcatccgccgccaatcccggctccggcccagtgacccagaggcaaaggtcctggactac
cagacacaacagcagaaactctttcctcagctggccatcagttatgccttccatttcctg
gcagtcagcctcttggagttcttccagcactcctacactgccattctgaaccaagacttc
agcttcctgcctgagctccacgcactgagcacgggcatgaaggccatgatgtcagaattc
tgcacccagggagctgagatgtgccgcagggcctgtggcggacatggctactcaaagctg
agtggcctgccatcactggtcaccaaattgtcggcctcctgtacctacgagggtgagaac
acagtgctctacctgcaggtggccaggttcctggtgaagagctacctgcagactcagatg
tcccctggctccacgccacagagatctctctctccatctgtcgcatatctcaccgcacct
gacctggccaggtgtccagcccagagggcagccgacttcctctgcccggagctctacacc
acggcctgggcacatgtggcagtaaggctcataaaggactcagtgcagcatttacagacc
ctgacgcaatccggagctgaccagcacgaggcttggaaccagaccactgtcatacacctc
caggctgctaaggtgcactgctactatgtcactgtgaagggttttacagaagctctggag
aaactagaaaatgaaccagcgattcagcaggtgctcaagcgcctctgtgacctccatgcc
atacatggaatcttgactaactcgggtgactttctccatgacgccttcctgtctggtgcc
caagtggacatggcaagaacagcctacctggacctgctccgcctgatccggaaggatgcc
atcctgttaactgatgcttttgacttcaccgatcagtgtttaaattcagcacttggctgt
tatgatggaaacgtctacgaacgcctgttccagtgggctcagaagtcaccaaccaatact
caggagaaccctgcctatgaggaatatataagaccacttttacaaagttggagatccaag
ctatga

DBGET integrated database retrieval system