KEGG   Homo sapiens (human): 831Help
Entry
831               CDS       T01001                                 

Gene name
CAST, BS-17, PLACK
Definition
(RefSeq) calpastatin
  KO
K04281  
calpastatin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q15
AA seq 695 aa AA seqDB search
MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEH
TEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAI
SGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGP
EVSDPMSSTYIEELGKREVTIPPKYRELLAKPIGPDDAIDALSSDFTCGSPTAAGKKTEK
EESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIK
EVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELS
EDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDA
VEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKP
LLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQA
GAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDT
IPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAK
DKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccacagaaaccaaggccattccagtcagccaacagatggaaggaccacatctt
cctaacaagaaaaaacacaaaaaacaggctgtaaaaacagaacctgagaagaagtcacag
tcaaccaagctgtctgtggttcatgagaaaaaatcccaagaaggaaagccaaaagaacac
acagagccaaaaagcctacccaagcaggcatcagatacaggaagtaacgatgctcacaat
aaaaaagcagtttccagatcagctgaacagcagccatcagagaaatcaacagaaccaaag
actaaaccacaagacatgatttctgctggtggagagagtgttgctggtatcactgcaata
tctggcaagccgggtgacaagaaaaaagaaaagaaatcattaaccccagctgtgccagtt
gaatctaaaccggataaaccatcgggaaagtcaggcatggatgctgctttggatgactta
atagatactttaggaggacctgaagaaactgaagaagaaaatacaacgtatactggacca
gaagtttcagatccaatgagttccacctacatagaggaattgggtaaaagagaagtcaca
attcctccaaaatatagggaactattggctaaacccatagggccagatgatgctatagac
gccttgtcatctgacttcacctgtgggtcgcctacagctgctggaaagaaaactgaaaaa
gaggaatctacagaagttttaaaagctcagtcagcagggacagtcagaagtgctgctcca
ccccaagagaagaaaagaaaggtggagaaggatacaatgagtgatcaagcactcgaggct
ctgtcggcttcactgggcacccggcaagcagaacctgagctcgacctccgctcaattaag
gaagtcgatgaggcaaaagctaaagaagaaaaactagagaagtgtggtgaggatgatgaa
acaatcccatctgagtacagattaaaaccagccacggataaagatggaaaaccactattg
ccagagcctgaagaaaaacccaagcctcggagtgaatcagaactcattgatgaactttca
gaagattttgaccggtctgaatgtaaagagaaaccatctaagccaactgaaaagacagaa
gaatctaaggccgctgctccagctcctgtgtcggaggctgtgtgtcggacctccatgtgt
agtatacagtcagcaccccctgagccggctaccttgaagggcacagtgccagatgatgct
gtagaagccttggctgatagcctggggaaaaaggaagcagatccagaagatggaaaacct
gtgatggataaagtcaaggagaaggccaaagaagaagaccgtgaaaagcttggtgaaaaa
gaagaaacaattcctcctgattatagattagaagaggtcaaggataaagatggaaagcca
ctcctgccaaaagagtctaaggaacagcttccacccatgagtgaagacttccttctggat
gctttgtctgaggacttctctggtccacaaaatgcttcatctcttaaatttgaagatgct
aaacttgctgctgccatctctgaagtggtttcccaaaccccagcttcaacgacccaagct
ggagccccaccccgtgatacctcgcagagtgacaaagacctcgatgatgccttggataaa
ctctctgacagtctaggacaaaggcagcctgacccagatgagaacaaaccaatggaagat
aaagtaaaggaaaaagctaaagctgaacatagagacaagcttggagaaagagatgacact
atcccacctgaatacagacatctcctggatgataatggacaggacaaaccagtgaagcca
cctacaaagaaatcagaggattcaaagaaacctgcagatgaccaagaccccattgatgct
ctctcaggagatctggacagctgtccctccactacagaaacctcacagaacacagcaaag
gataagtgcaagaaggctgcttccagctccaaagcacctaagaatggaggtaaagcgaag
gattcagcaaagacaacagaggaaacttccaagccaaaagatgactaa

DBGET integrated database retrieval system