KEGG   Homo sapiens (human): 8310Help
Entry
8310              CDS       T01001                                 

Gene name
ACOX3
Definition
acyl-CoA oxidase 3, pristanoyl (EC:1.3.3.6)
Orthology
K00232  
acyl-CoA oxidase [EC:1.3.3.6]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
cAMP signaling pathway
Peroxisome
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    8310 (ACOX3)
  Lipid metabolism
   00071 Fatty acid degradation
    8310 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    8310 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    8310 (ACOX3)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    8310 (ACOX3)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    8310 (ACOX3)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    8310 (ACOX3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     8310 (ACOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.3
AA seq 624 aa AA seqDB search
MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPL
FARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAK
YLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPAT
EEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMP
GVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGAS
LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYL
AAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQ
ECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFR
SPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSG
SSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSL
SRHAALLYRAERRCSCPGRRDRSS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcatccactgtggaaggaggcgacacagctctgctcccagaattccccagggggccc
ctcgatgcctaccgagcaagagcgtccttcagctggaaggagctggcgctgttcacggaa
ggggagggcatgctccgctttaagaaaaccatcttctcagctcttgagaatgaccctctt
ttcgctcgttcccctggagccgatctgtccttggagaagtatcgcgagctgaacttcctt
cgatgcaagcggatcttcgagtatgacttcctcagtgtcgaagacatgttcaagagccct
ctgaaggtccccgccttgattcagtgcctgggcatgtatgactcttctctggctgccaag
tacctcctccatagcttggtttttggatcagcagtttacagttctggttctgaaagacat
ctcacatatattcaaaagatcttcaggatggagatttttggatgttttgctctgaccgaa
ttaagccacggcagtaataccaaggccattcgcacaactgcccactacgatcctgccact
gaggaattcatcatacattcccctgatttcgaagctgccaagttttgggttggcaacatg
ggcaagacagccactcacgcggtggtgtttgctaagctgtgtgtgccaggggaccagtgc
catgggctgcatccctttatcgtgcagatccgggacccgaagacccttcttcccatgcct
ggagtgatggttggcgacataggaaaaaaactcgggcagaacggtctggataatggtttc
gccatgttccacaaggtcagagttcctcgccagagccttctgaaccggatgggagacgtc
acccccgagggcacctatgtcagcccctttaaggacgtcaggcagcgctttggagcgtcc
ctggggagcctgtcctcgggccgggtctccatcgtgagcctggccatccttaacctaaag
ctggccgtggccatcgctcttcgcttctcagccactcggcgtcagtttggacccacagag
gaggaggaaataccagtgcttgagtatccaatgcagcaatggcgcttgcttccatatctg
gcagctgtctacgccttagaccatttctccaagtcgctcttcctggacctggtggagctc
cagcgaggacttgcatcgggagaccgcagcgccagacaggcagagcttggacgtgagatc
cacgccctggcatcggccagcaagcccctggcctcgtggaccacccagcaaggaattcag
gaatgccgggaggcgtgtggaggacacggctatctggccatgaaccggttgggtgtcctt
agagatgacaacgatcccaactgcacatacgaaggtgacaacaacatcctgctgcagcag
acaagcaactatttgctgggtctcctggcacaccaggtccacgatggagcttgcttccgc
agtccgctgaagtcagtggactttctggacgcctatcccggcatccttgaccagaagttt
gaggtctccagtgttgccgactgcttggactctgcagtcgccctggcagcatacaagtgg
ctggtttgctacctgctccgagagacttatcaaaaattaaaccaagagaaaagatcagga
agcagtgactttgaagcaaggaacaaatgccaggtgtcccacggccgtccgttggcgctg
gccttcgtggagctcacggtggtccagaggttccacgagcacgtgcaccagccttccgtg
ccgccctcgctgcgggccgtgctggggcggctcagtgctctgtacgccctgtggtccctg
agccgccacgcggccctgctctaccgagctgaaagacgatgcagttgccctggtagacgt
gatcgctcctcctga

DBGET integrated database retrieval system