KEGG   Homo sapiens (human): 8313Help
Entry
8313              CDS       T01001                                 

Gene name
AXIN2, AXIL, ODCRCS
Definition
axin 2
Orthology
K04385  
axin 2
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Pathways in cancer
Colorectal cancer
Endometrial cancer
Basal cell carcinoma
Disease
H00625  
Tooth agenesis
H00857  
Oligodontia-colorectal cancer syndrome
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q23-q24
AA seq 843 aa AA seqDB search
MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgctatgttggtgacttgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgacccggtggaccaag
tccttacactccttattgggcgatcaagacggtgcttacctgttccgaactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactcgggagcctaaaggtc
gtgtgtggctatctccccaccttgaatgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaaccgtggttggcttgtccagcaaaactctgagggccacggcgagt
gtgaggtccacggaaactgttgacagtggatacaggtccttcaagaggagcgatcctgtt
aatccttatcacataggttctggctatgtctttgcaccagccaccagcgccaacgacagt
gagatatccagtgatgcgctgacggatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcagctgagctgatctcgaggctggaaaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagagagagggctccgagctcacactcaattcgcgggagggggcgcccacgcag
caccccctctccctactgccctccggcagctacgaggaagacccgcagacgatactggac
gatcacctgtccagggtcctcaagacccctggctgccagtctccaggcgtaggccgctat
agcccccgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcccgcccggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaaaggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccac
caccatgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcagcgagtattactgctactcgaaatgcaaaagccactccaag
gctccggaaaccatgcccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacagcgggcacccccgcaccaccccccgtgcccacctgttcacc
caggaccctgcgatgcctcccctgaccccacccaacacgctggctcagctggaggaggcc
tgtcgcaggctagctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaatcattcggccactgttcagacgggagccacacccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccacgcgctccag
gccagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtgtttgaggag
atctgggaggatgagacggtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

DBGET integrated database retrieval system