KEGG   Homo sapiens (human): 8314Help
Entry
8314              CDS       T01001                                 

Gene name
BAP1, HUCEP-13, UCHL2
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     8314 (BAP1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   8314 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31-p21.2
AA seq 729 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANR
APAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVE
KEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgacccaggcctcttcaccctgctcgtggaa
gatttcggtgtcaagggggtgcaagtggaggagatctacgaccttcagagcaaatgtcag
ggccctgtatatggatttatcttcctgttcaaatggatcgaagagcgccggtcccggcga
aaggtctctaccttggtggatgatacgtccgtgattgatgatgatattgtgaataacatg
ttctttgcccaccagctgatacccaactcttgtgcaactcatgccttgctgagcgtgctc
ctgaactgcagcagcgtggacctgggacccaccctgagtcgcatgaaggacttcaccaag
ggtttcagccctgagagcaaaggatatgcgattggcaatgccccggagttggccaaggcc
cataatagccatgccaggcccgagccacgccacctccctgagaagcagaatggccttagt
gcagtgcggaccatggaggcgttccactttgtcagctatgtgcctatcacaggccggctc
tttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggacgag
gagtggacagacaaggcccggcgggtcatcatggagcgtatcggcctcgccactgcaggg
gagccctaccacgacatccgcttcaacctgatggcagtggtgcccgaccgcaggatcaag
tatgaggccaggctgcatgtgctgaaggtgaaccgtcagacagtactagaggctctgcag
cagctgataagagtaacacagccagagctgattcagacccacaagtctcaagagtcacag
ctgcctgaggagtccaagtcagccagcaacaagtccccgctggtgctggaagcaaacagg
gcccctgcagcctctgagggcaaccacacagatggtgcagaggaggcggctggttcatgc
gcacaagccccatcccacagccctcccaacaaacccaagctagtggtgaagcctccaggc
agcagcctcaatggggttcaccccaaccccactcccattgtccagcggctgccggccttt
ctagacaatcacaattatgccaagtcccccatgcaggaggaagaagacctggcggcaggt
gtgggccgcagccgagttccagtccgcccaccccagcagtactcagatgatgaggatgac
tatgaggatgacgaggaggatgacgtgcagaacaccaactctgcccttaggtataagggg
aagggaacagggaagccaggggcattgagcggttctgctgatgggcaactgtcagtgctg
cagcccaacaccatcaacgtcttggctgagaagctcaaagagtcccagaaggacctctca
attcctctgtccatcaagactagcagcggggctgggagtccggctgtggcagtgcccaca
cactcgcagccctcacccacccccagcaatgagagtacagacacggcctctgagatcggc
agtgctttcaactcgccactgcgctcgcctatccgctcagccaacccgacgcggccctcc
agccctgtcacctcccacatctccaaggtgctttttggagaggatgacagcctgctgcgt
gttgactgcatacgctacaaccgtgctgtccgtgatctgggtcctgtcatcagcacaggc
ctgctgcacctggctgaggatggggtgctgagtcccctggcgctgacagagggtgggaag
ggttcctcgccctccatcagaccaatccaaggcagccaggggtccagcagcccagtggag
aaggaggtcgtggaagccacggacagcagagagaagacggggatggtgaggcctggcgag
cccttgagtggggagaaatactcacccaaggagctgctggcactgctgaagtgtgtggag
gctgagattgcaaactatgaggcgtgcctcaaggaggaggtagagaagaggaagaagttc
aagattgatgaccagagaaggacccacaactacgatgagttcatctgcacctttatctcc
atgctggctcaggaaggcatgctggccaacctagtggagcagaacatctccgtgcggcgg
cgccaaggggtcagcatcggccggctccacaagcagcggaagcctgaccggcggaaacgc
tctcgcccctacaaggccaagcgccagtga

DBGET integrated database retrieval system